Entry information : PcarMnP01
Entry ID 9868
Creation 2011-12-02 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP01
Name PcarMnP01
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP01
start..stop
S start..stop
PcarMnP07 702 0 1..385 1..385
PcarMnP06 664 0 1..383 1..383
PcarMnP05 635 0 1..385 1..385
PbreMnP05 617 0 26..385 23..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3181628..3181762 135 N° 2 3181519..3181570 52 N° 3 3181439..3181465 27 N° 4 3181336..3181375 40
N° 5 3181101..3181278 178 N° 6 3180816..3181037 222 N° 7 3180337..3180751 415 N° 8 3180185..3180273 89
complement(join(3180185..3180273,3180337..3180751,3180816..3181037,3181101..3181 278,3181336..3181375,3181439..3181465,3181519..3181570,3181628..3181762))


exon

Literature and cross-references PcarMnP01
DNA ref. JGI genome:   scaffold_5 (3181762..3180185)
Protein sequence: PcarMnP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   386 (365)
PWM (Da):   %s   39936.5 (37740.3)  
PI (pH):   %s   4.03 (3.94) Peptide Signal:   %s   cut: 21 range:21-385
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKFSSLFALVAVAATVRAAPASTTTTCSDGTQVPDEMCCNFVPLVSALQNTLFMGDCGEDAHEVIRLTFHDAIAISQSQGPAAGGGADGSMLIFPTVEPSFAANTGIGDSVNNLIPFLSQFPNVTAGDLIQFAGTVALSNCPGAPQLEFLAGRPNATAPAVDGLIPGPQDSVTSILDRFADAGGFSPFEVISLLASHSIARADKVDPTIDAAPFDSTPFVFDTQVFLEVLLKGVGFPGTPNNTGEVASPLPLTVGSDTGELRLQSDFALARDSRTACFWQGFVNQQELMASSFQAAMSKMTILGHNRADLVDCSAVVPVPKPAVNKPASFPATTGPQDLELSCTTSQFPTLTVDAGSQETEIPHCSDGSMTCNTVQFTGPAVD*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAATTCTCTTCACTTTTCGCCCTCGTCGCCGTTGCTGCGACCGTGCGCGCCGCTCCGGCTTCCACCACCACCACCTGCTCCGATGGCACACAGGTCCCCGACGAAATGTGC
TGCAACTTCGTCCCT
GTACGTCTACTTCGTATCACCCTGCGCTACGACGGTGGCTGAATTTCTTGAATGCAGCTCGTGTCAGCGCTCCAGAACACGCTATTCATGGGAGACTGTGGTGAA
GACG
GTAGGCCGTTTGCCTTCCCGCTTTGTAGCAACAAGGTTGAAATCTCTTCCTAGCTCACGAGGTCATCCGTCTTACTTTCCGTGAGTGACATTTGTGTCGAAGCCAGTTACCGGTTA
CCAGCATACTTACTATTACCTTGCCAGACGACGCCATCGCTATCTCTCAGAGCCAGGGTCCCGCAGCGTGAGTGTGACCACGCCTTGATCCGTAGTCTGAAGGTTGTTGACCCCGAATGT
ACAGCGGAGGAGGAGCCGACGGGTCGATGCTCATCTTCCCGACCGTTGAGCCATCGTTCGCAGCGAACACGGGCATCGGCGACAGTGTCAACAACCTGATTCCGTTCCTGTCCCAGTTCC
CCAACGTCACCGCTGGCGACCTGATCCAGTTCGCAGGCACGGTCGCACTGAGCAACTGCCCG
GTAAGCAACCGCAGACTGCCCAGCTCCTGCTGTACTTCGTGCTCACACAATCTCCAAC
AACAGGGTGCGCCGCAGCTGGAGTTCCTTGCTGGTCGCCCGAATGCGACTGCGCCGGCCGTTGACGGCTTAATCCCCGGGCCGCAGGATAGCGTCACGTCGATCCTCGACCGGTTTGCCG
ATGCTGGCGGCTTCAGCCCCTTCGAAGTCATCTCCCTCCTTGCCTCTCACTCCATTGCTCGTGCCGACAAGGTTGACCCGACGATCGACGCCGCGCCTTTCGACTCC
GTAATTATCCGTG
CTTCCTCTCCCTTGGGAGTCGGACTCCACTGACAATAATCTACTCGTGCAGACTCCATTCGTGTTCGACACTCAGGTCTTCCTCGAGGTCCTGCTCAAGGGTGTCGGCTTCCCTGGCACC
CCCAACAACACCGGCGAGGTCGCCTCTCCGCTCCCGCTCACCGTCGGCAGCGACACCGGCGAGCTGCGTCTGCAATCGGACTTTGCGCTGGCGCGCGACTCACGCACGGCGTGCTTCTGG
CAGGGCTTCGTCAACCAGCAGGAGCTCATGGCATCGAGCTTCCAGGCGGCCATGTCCAAGATGACGATCCTCGGCCACAACCGCGCCGATCTCGTTGACTGCTCGGCCGTCGTCCCTGTG
CCGAAGCCCGCGGTCAACAAGCCTGCGAGCTTCCCGGCGACGACTGGCCCTCAGGACCTGGAGCTGTCGTGCACGACCTCGCAATTCCCGACGCTGACCGTCGACG
GTATGTGTTTTCCA
GGTGTGCTCGCTTGCTGTCCAATGAAGCTGACTCTCGACTCTGGTACAGCCGGCTCACAGGAGACGGAGATCCCGCACTGCTCGGACGGCAGCATGACGTGCAACACTGTCCAGTTCACC
GGCCCGGCTGTCGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAATTCTCTTCACTTTTCGCCCTCGTCGCCGTTGCTGCGACCGTGCGCGCCGCTCCGGCTTCCACCACCACCACCTGCTCCGATGGCACACAGGTCCCCGACGAAATGTGC
TGCAACTTCGTCCCT
CTCGTGTCAGCGCTCCAGAACACGCTATTCATGGGAGACTGTGGTGAAGACGCTCACGAGGTCATCCGTCTTACTTTCCACGACGCCATCGCTATCTCTCAGAGC
CAGGGTCCCGCAGC
CGGAGGAGGAGCCGACGGGTCGATGCTCATCTTCCCGACCGTTGAGCCATCGTTCGCAGCGAACACGGGCATCGGCGACAGTGTCAACAACCTGATTCCGTTCCTG
TCCCAGTTCCCCAACGTCACCGCTGGCGACCTGATCCAGTTCGCAGGCACGGTCGCACTGAGCAACTGCCCG
GGTGCGCCGCAGCTGGAGTTCCTTGCTGGTCGCCCGAATGCGACTGCG
CCGGCCGTTGACGGCTTAATCCCCGGGCCGCAGGATAGCGTCACGTCGATCCTCGACCGGTTTGCCGATGCTGGCGGCTTCAGCCCCTTCGAAGTCATCTCCCTCCTTGCCTCTCACTCC
ATTGCTCGTGCCGACAAGGTTGACCCGACGATCGACGCCGCGCCTTTCGACTCC
ACTCCATTCGTGTTCGACACTCAGGTCTTCCTCGAGGTCCTGCTCAAGGGTGTCGGCTTCCCTGGC
ACCCCCAACAACACCGGCGAGGTCGCCTCTCCGCTCCCGCTCACCGTCGGCAGCGACACCGGCGAGCTGCGTCTGCAATCGGACTTTGCGCTGGCGCGCGACTCACGCACGGCGTGCTTC
TGGCAGGGCTTCGTCAACCAGCAGGAGCTCATGGCATCGAGCTTCCAGGCGGCCATGTCCAAGATGACGATCCTCGGCCACAACCGCGCCGATCTCGTTGACTGCTCGGCCGTCGTCCCT
GTGCCGAAGCCCGCGGTCAACAAGCCTGCGAGCTTCCCGGCGACGACTGGCCCTCAGGACCTGGAGCTGTCGTGCACGACCTCGCAATTCCCGACGCTGACCGTCGACG
CCGGCTCACAG
GAGACGGAGATCCCGCACTGCTCGGACGGCAGCATGACGTGCAACACTGTCCAGTTCACCGGCCCGGCTGTCGACTAA

Retrieve as FASTA