Entry information : ZmPrx91
Entry ID 987
Creation 2007-11-12 (Christophe Dunand)
Last sequence changes 2011-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-02-17 (Christophe Dunand)
Peroxidase information: ZmPrx91
Name ZmPrx91
Class Class III peroxidase    [Orthogroup: Prx177]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx91
start..stop
S start..stop
SbPrx95 599 0 4..321 5..321
SiPrx55 573 0 1..321 1..320
OsPrx57 547 0 3..321 4..319
BdiPrx133 498 9e-180 24..321 28..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4989515..4989724 210 N° 2 4990043..4990234 192 N° 3 4990362..4990925 564  
join(4989515..4989724,4990043..4990234,4990362..4990925)


exon

Literature and cross-references ZmPrx91
Literature Walbot,V., unpublished.
Protein sequence: ZmPrx91
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   33764.38 (31388.2)  
PI (pH):   %s   4.61 (4.54) Peptide Signal:   %s   cut: 24 range:24-321
Sequence 362
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRQTFACYTMALLFAAAAVSAQLSTDFYDDTCPDALDIIESAVRAAVSKESRMGASLLRLHFHDCFVNGCDGSVLLDDALGFTGEKTAQPNKNSLRGFDVVDDIKAQLEDACNQTVSCADILAVAARDSVVALGGPTWDVELGRRDGTTANLDDANNDLPAPTLDLGDLIKAFSKKGLSASDMIALSGGHTIGQARCVNFRGRLYNETASLDASLASSLKPRCPGAAGSGDDNTSPLDPATSYVFDNFYYRNLLRNKGLLHSDQQLFSGGGSADAQTTAYASDMAGFFDDFRDAMVKMGAIGVVTGSGGHVRVNCRKTN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2) and 3 ESTs. Strain="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCCAGGCAGACCTTCGCCTGCTACACCATGGCCCTGCTGTTCGCTGCGGCTGCTGTCTCGGCGCAGCTCTCCACCGACTTCTACGACGACACATGCCCCGACGCGCTCGACATCA
TCGAGTCCGCAGTGAGAGCTGCCGTCTCCAAGGAGTCCCGCATGGGGGCCTCCCTCCTCCGCCTCCATTTCCACGACTGCTTTGTCAAT
GCAAGTGCCATGTGCCACACCTCTAAATTTC
CTTCAGCCTTCCACTTTTGTTTTTCCCATGAAGTTACGTTAAACTGATGCCATGCATGAGCTAGCCGTTGACTGAACTGACGGGCTTCGGTTAGATCTTCTACTGTTTTGGGCGGAGTGT
TTAGAATCTTGCTTATTAGGCATAGCACATCATATGTTGGTTCAGACATTCAGTAGACAGTTGTGGATAGTGTGTGTCAGCTACTCAGCTTCAAATCTGGTGCTCTACGAGTCAAAGAGT
GCTTTTCGTGGACTAACCGTTGACTGCAATGCAAACTAACTTTGCAGGGCTGTGACGGGTCAGTGCTGCTCGACGACGCACTGGGCTTTACCGGCGAGAAGACGGCGCAGCCGAACAAGA
ACTCTCTCCGCGGGTTCGACGTGGTTGACGACATCAAGGCGCAGCTCGAGGACGCATGCAACCAGACAGTCTCCTGCGCCGACATCCTCGCAGTCGCCGCCCGCGACTCCGTCGTCGCC
G
TAAGCACGACATGCACAAAGACCAAGCAAGACTAGCTGCATATGCTAGCTTTTTTCCATTCGATTTCCATGCATGGTGGTGAGTGGTGACAAGCTAATTGCACCATCTCCTCTGCATGCA
ATGCAGCTCGGCGGTCCTACGTGGGACGTGGAGCTCGGCCGGCGGGACGGGACGACGGCGAACCTGGACGACGCGAACAACGACCTCCCAGCGCCGACCCTGGACCTCGGTGACCTCATC
AAGGCCTTCTCCAAGAAGGGGCTGAGCGCGAGCGACATGATCGCGCTGTCGGGCGGACACACGATCGGGCAGGCGCGGTGCGTCAACTTCCGCGGCCGCCTCTACAACGAGACCGCCAGC
CTGGACGCGTCGCTGGCGTCGTCGCTGAAGCCGCGGTGCCCGGGCGCGGCCGGCAGCGGCGACGACAACACGTCGCCGCTGGACCCGGCCACGTCCTACGTCTTCGACAACTTCTACTAC
AGGAACCTGCTGCGGAACAAGGGCCTGCTCCACTCGGACCAGCAGCTCTTCAGCGGCGGCGGCTCCGCGGACGCGCAGACCACCGCCTACGCGTCCGACATGGCTGGCTTCTTCGACGAC
TTCCGCGACGCCATGGTGAAGATGGGCGCCATCGGCGTGGTCACTGGGTCCGGGGGGCATGTTAGAGTGAACTGCCGGAAGACGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCCAGGCAGACCTTCGCCTGCTACACCATGGCCCTGCTGTTCGCTGCGGCTGCTGTCTCGGCGCAGCTCTCCACCGACTTCTACGACGACACATGCCCCGACGCGCTCGACATCA
TCGAGTCCGCAGTGAGAGCTGCCGTCTCCAAGGAGTCCCGCATGGGGGCCTCCCTCCTCCGCCTCCATTTCCACGACTGCTTTGTCAAT
GGCTGTGACGGGTCAGTGCTGCTCGACGACG
CACTGGGCTTTACCGGCGAGAAGACGGCGCAGCCGAACAAGAACTCTCTCCGCGGGTTCGACGTGGTTGACGACATCAAGGCGCAGCTCGAGGACGCATGCAACCAGACAGTCTCCTGCG
CCGACATCCTCGCAGTCGCCGCCCGCGACTCCGTCGTCGCC
CTCGGCGGTCCTACGTGGGACGTGGAGCTCGGCCGGCGGGACGGGACGACGGCGAACCTGGACGACGCGAACAACGACC
TCCCAGCGCCGACCCTGGACCTCGGTGACCTCATCAAGGCCTTCTCCAAGAAGGGGCTGAGCGCGAGCGACATGATCGCGCTGTCGGGCGGACACACGATCGGGCAGGCGCGGTGCGTCA
ACTTCCGCGGCCGCCTCTACAACGAGACCGCCAGCCTGGACGCGTCGCTGGCGTCGTCGCTGAAGCCGCGGTGCCCGGGCGCGGCCGGCAGCGGCGACGACAACACGTCGCCGCTGGACC
CGGCCACGTCCTACGTCTTCGACAACTTCTACTACAGGAACCTGCTGCGGAACAAGGGCCTGCTCCACTCGGACCAGCAGCTCTTCAGCGGCGGCGGCTCCGCGGACGCGCAGACCACCG
CCTACGCGTCCGACATGGCTGGCTTCTTCGACGACTTCCGCGACGCCATGGTGAAGATGGGCGCCATCGGCGTGGTCACTGGGTCCGGGGGGCATGTTAGAGTGAACTGCCGGAAGACGA
ACTAA

Retrieve as FASTA