Entry information : GmPrx329 (Glyma.16G164200 )
Entry ID 9871
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-01 (Christophe Dunand)
Peroxidase information: GmPrx329 (Glyma.16G164200 )
Name (synonym) GmPrx329 (Glyma.16G164200 )
Class Class III peroxidase    [Orthogroup: Prx162]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx329
start..stop
S start..stop
LjPrx11 578 0 1..345 1..351
MtPrx48 545 0 1..345 1..352
GmPrx276 495 1.3e-177 9..342 11..345
GmPrx32 467 1.41e-166 9..337 17..343
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9871' 'complement(join(31827802..31828410,31829659..31829844,31830226..31830468))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31830226..31830468 241 N° 2 31829659..31829844 184 N° 3 31827802..31828410 607  
complement(join(31827802..31828410,31829659..31829844,31830226..31830468))


exon

Literature and cross-references GmPrx329 (Glyma.16G164200 )
DNA ref. Phytozome 12:   Gm16 (31830468..31827802)
Protein sequence: GmPrx329 (Glyma.16G164200 )
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (317)
PWM (Da):   %s   37603.27 (34507.7)  
PI (pH):   %s   7.41 (7.36) Peptide Signal:   %s   cut: 29 range:29-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARSSAYPLFLISSILFISHIYASQVEAKPPVVKGLSYSFYSKTC
PKLESIVRKHLKKVFKDDNGQAPALLRIFFHDCFVQ
GCDGSLLLDGSPSERDQPANGGIRTEALQTIDDIRAIIHKECGRIVSCADITVLAARDSVFLTGGPDYAVPLGRRDGLSFSTSGTSDLPKPFNTTGVTLDAFAAKNFDVTDVVALSGAHT
FGRAHCGTFFNRLSPLDPNMDKTLAKQLQSTCPDANSGNTVNLDIRTPTVFDNKYYLDLMNRQGVFTSDQDLLNDKRTKGLVNAFALNQTLFFEKFVDATIKLSQLDVLTGNQGEIRGKC
NVVNARKSLLTSVVEEVVQLVDQF*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGTCTAGTGCTTATCCTTTGTTCTTGATTTCTTCCATTCTGTTTATTTCACACATTTATGCCTCCCAAGTAGAAGCCAAGCCCCCAGTAGTGAAGGGACTATCATATTCTTTC
TATTCCAAAACATGCCCCAAGCTTGAGTCCATTGTGAGGAAACATCTCAAGAAGGTGTTCAAGGATGACAATGGCCAAGCTCCTGCCTTACTCCGCATTTTCTTCCATGATTGTTTTGTT
CAG
GTAATTTTTTTTTTATCGAAAAATGTTAATTGTTAGAATTATAATTTATTAATAAAAGAGATCAAATTCACTACTTTTCTTACCTTTCCTTAATCATCTATGTTTTGCTAGAATAAT
ATAATGCTATTCGATCAGGCAAAAGTGATTAGTTATATAAATTCCATGATAAAAGAAAAAAATATTAAAAATGAGTACCCATGAAGTATTTTAACTCATGGATCAAACTTCTGAAGATCG
AGTAACTTATTTTGGAGAATAAAGTAACAAGGAGAAAAAAGTTGCAACTACAGAGCATGTTTCACCAATAAGGTTAATATATATGCATGCATATATATATATAGAAAAAAGATATTACCT
CTAACTTAATTTGCATTTGTATAGGGGGATGTGATGGATCATTGCTGCTAGATGGGAGTCCAAGTGAAAGAGACCAACCAGCCAACGGAGGCATCAGAACTGAGGCCTTGCAAACCATTG
ATGACATCAGAGCTATTATCCATAAGGAGTGTGGAAGGATCGTTTCTTGCGCAGATATCACTGTTTTGGCAGCACGTGATTCAGTTTTCCTT
GTAATCTCTTCATCCCTCTTACCTTTAC
TTGCACTACTATTTTGGTTCTCAAAACCCTCTGCTCTTACTAACTATAGTTTTGAAGCTTTTCTTTGTGATATATACAAGTTTAACTTTTATTCATGTGTACGTTAAGATTTTTACATTA
TCAACGAAATAAAAAAATAATGTAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNTTAGGATAAATAATTGAATTTTGAACGTTAGAAAGTTAGAATAATTTACAGGTAAAAATTCCATCCTTATATGATGACGAACTCTAAAATGTTGTCCATTGTTT
GGGGCAGACGAACAAAAGTTGCACTCCTTGAATGTTAGTTAGTCAAAGTTACATTATTAAATGTACTCGGTTTGTACTAAAAGTAAAATAAAAAAATATAAGAACATAAAAGTGAATGTA
AAAGAAAGTAGAAAGTAGAGAAAATTTTCTCATCATGTTTAAATGAATGAAAAAGTGGATAGAAGTAAAAATTTAAAGTATTTTAAAAATATTTTGTATTATTTAAAAAAAATAATGTAA
TTAAAAAATAGAAACTTTTATTATACGGAATATTATTTTTCTTTATATAAAATTCACAAAAAATATTTCCTTTTTCTTTTTTATTATCTTAAAAAATAATAACAATATTACTTTCATCAA
ATATCTGTCGTCTCCANNNNNNNNNNNNNNNNNNNNNNNNNNAGACTCATCCATACTTAGTGTAAAGTAATTATCCCTCTTTCAACTTTAACAATAGCCATATTATTTTACTTAAAAGTG
GTTTCAGTAATTTAATACTATTAACACTTTATTCTACATAAATAAATCAGGCAAGGCTTTAAGAAATGGAGATAATGATGGAGTCGTTATCATCGACACTCAAGTGTCGAGATGGTAGTG
CTAATCTATCTGTATATAAATCAGAAAATAAATTAAATAATCCAAGCATGTAATAGTCTGCCTGTAAAGTTAGACTAAACTTTGAAATCGTAAAATATTTTGTTCGATGTTTGTGGGGCG
TAGCCATTTAATTATCTAGGAATTCCGAGTAAAAATTTGTATCCTTTTCACTATGGCAATTCCTTTCAAAAACACTTATATCTTATATTCAAAATGACACTTAATTTGATTTATTAATAA
TTTGTTTTTACTTTGAACAGACACAGGAGGTCCCGATTATGCAGTGCCACTAGGAAGACGAGATGGCCTGAGCTTCAGCACATCAGGAACAAGTGATCTCCCCAAACCCTTCAACACCAC
CGGCGTGACCCTTGACGCTTTCGCCGCCAAAAACTTTGATGTCACCGACGTTGTCGCCTTATCCGGCGCACACACCTTTGGTCGTGCCCATTGCGGCACATTCTTCAACAGGCTCTCCCC
TCTCGACCCCAACATGGACAAAACCCTAGCCAAGCAACTACAATCCACTTGCCCCGACGCAAACTCCGGCAACACCGTCAACTTGGACATCAGAACCCCGACTGTGTTCGACAACAAATA
CTACCTTGACCTAATGAACCGCCAAGGGGTGTTCACCTCTGACCAGGACTTGCTCAATGATAAGAGGACTAAGGGGTTGGTCAATGCATTTGCGTTGAACCAAACGTTGTTCTTTGAGAA
GTTTGTGGATGCTACTATAAAGTTGAGTCAATTGGATGTGCTCACTGGAAATCAAGGTGAAATTCGTGGCAAGTGCAATGTGGTGAATGCTAGGAAGTCTTTGTTGACGTCTGTGGTGGA
AGAGGTGGTGCAATTGGTTGATCAGTTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGGTCTAGTGCTTATCCTTTGTTCTTGATTTCTTCCATTCTGTTTATTTCACACATTTATGCCTCCCAAGTAGAAGCCAAGCCCCCAGTAGTGAAGGGACTATCATATTCTTTC
TATTCCAAAACATGCCCCAAGCTTGAGTCCATTGTGAGGAAACATCTCAAGAAGGTGTTCAAGGATGACAATGGCCAAGCTCCTGCCTTACTCCGCATTTTCTTCCATGATTGTTTTGTT
CAG
GGATGTGATGGATCATTGCTGCTAGATGGGAGTCCAAGTGAAAGAGACCAACCAGCCAACGGAGGCATCAGAACTGAGGCCTTGCAAACCATTGATGACATCAGAGCTATTATCCAT
AAGGAGTGTGGAAGGATCGTTTCTTGCGCAGATATCACTGTTTTGGCAGCACGTGATTCAGTTTTCCTT
ACAGGAGGTCCCGATTATGCAGTGCCACTAGGAAGACGAGATGGCCTGAGC
TTCAGCACATCAGGAACAAGTGATCTCCCCAAACCCTTCAACACCACCGGCGTGACCCTTGACGCTTTCGCCGCCAAAAACTTTGATGTCACCGACGTTGTCGCCTTATCCGGCGCACAC
ACCTTTGGTCGTGCCCATTGCGGCACATTCTTCAACAGGCTCTCCCCTCTCGACCCCAACATGGACAAAACCCTAGCCAAGCAACTACAATCCACTTGCCCCGACGCAAACTCCGGCAAC
ACCGTCAACTTGGACATCAGAACCCCGACTGTGTTCGACAACAAATACTACCTTGACCTAATGAACCGCCAAGGGGTGTTCACCTCTGACCAGGACTTGCTCAATGATAAGAGGACTAAG
GGGTTGGTCAATGCATTTGCGTTGAACCAAACGTTGTTCTTTGAGAAGTTTGTGGATGCTACTATAAAGTTGAGTCAATTGGATGTGCTCACTGGAAATCAAGGTGAAATTCGTGGCAAG
TGCAATGTGGTGAATGCTAGGAAGTCTTTGTTGACGTCTGTGGTGGAAGAGGTGGTGCAATTGGTTGATCAGTTTTGA

Retrieve as FASTA