Entry information : GmPrx330
Entry ID 9872
Creation 2011-11-29 (Qiang Li)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx330
Name GmPrx330
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx330
start..stop
S start..stop
GmPrx63 612 0 1..320 1..320
GmPrx74 529 0 1..320 1..320
GmPrx249 528 0 1..320 1..319
CclPrx113 492 2e-177 1..320 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4827409..4827627 219 N° 2 4826544..4826735 192 N° 3 4825997..4826162 166 N° 4 4825405..4825790 386
complement(join(4825405..4825790,4825997..4826162,4826544..4826735,4827409..4827 627))


exon

Literature and cross-references GmPrx330
DNA ref. Phytozome 12:   Gm18 (4827627..4825405)
Protein sequence: GmPrx330
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (294)
PWM (Da):   %s   33856.5 (30941.0) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.59 (5.06) Peptide Signal:   %s   cut: 27 range:27-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFHSLRYNVFCFSILFSLLIALASAELSSDFYASTCPNALSTIKSAVKSAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSSFTGEKSAAANLNSLRGFDVIDDIKSQLESACPGIVSCADIVAVAARDSVVALGGPSWTIGLGRRDSTTASKDAATSDIPSPLMDLNDLISAFSNKGFTSQEMVVLSGAHTTGQAKCQFFRGRIYNETNIDSDFATSAKSNCPSTDGDSNLSPLDVTTNVLFDNAYFKNLVNKKGLLHSDQQLFSGGSTDSQVTTYSTSSSTFYADFASAMVKMGNLSPLTGSSGQIRTNCRNVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCATTCACTACGTTATAACGTATTTTGCTTCTCTATTTTGTTTTCTCTACTTATTGCCTTAGCCTCTGCTGAGCTATCTTCAGATTTCTATGCATCAACATGCCCCAATGCC
CTCTCTACCATAAAATCTGCAGTGAAAAGTGCAGTTGCTAAAGAGCATCGCATGGGAGCATCCTTGCTCCGTCTTCATTTCCATGATTGCTTTGTTAAT
GTACGTTCTTTCTTCTCTAAC
TCTTCCTTCATCTGTTTCACTCTGACTCATGCATGAAGTGCACGCATGCATATTCACACACGTATGACTTAGGTACAAAATATGTAGAATAAAAATAATTAACCAACTTATATTCTCACA
TGATATATTTGTTTTTAATTGTAAGTTATTGTTTCCTTTTTCCTTTTTCCTTTTGTGTGTCGTTAATACTATGATATTAGATGCATTCTTAATTTTTGTCATACATATATAGGAAGAAAT
TATTAAATATGGTCTTAGAACACATGATTCATCATTCACACATGACATATAATCAAATGATTATTAGAGTTCAAATAATTATATAATTACATTGTAAAACAGTTTTANNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTA
CATAATTTTTTTTCTCATATCATCAATTTTTGAATCGTAAATTGAAAAGCTTAAATACTTATCATGTAAAAATTGGACTTGGTCAAGGAATAGAATGTAGCCAGCTAGCTGGTATAAGTT
TCCATGCATTACACATTGTGTCTTCACTGATTGATTGTTATGAACCTCGTAGGGATGTGATGCATCAGTTCTTCTAGATGACACTTCGAGCTTCACGGGAGAAAAGTCAGCTGCTGCAAA
TTTGAATTCTTTGAGGGGTTTTGATGTAATTGACGACATCAAAAGTCAGTTGGAGAGTGCTTGTCCAGGAATTGTTTCCTGTGCAGATATTGTTGCTGTTGCTGCACGAGATTCTGTCGT
AGCA
GTAAGTTAATTTTACTTAATACAATAATCAGCATAAACGAACTCACCAACACACACACACACATACATATACTGTCTTTAAAATGGAAAAATGTCTAGTAATATTTAGAATAGAAA
CATTAATCGACATCTTGAATTTTTTTATCAAAAGATCCATGTTTTGAAATTTTTAGATATATAAATTAATTTAAGAGTAAATAGTCTATATATATTTGATATCATAGAGGAATTTTACAT
TTCATTCGATCACAATTTAACATATAATTTGTTAACTTTTATAATATATCTTTTGGAATGATTGATAATCTAACCTTTTCACATTAAAATATATGTATAGATATTAATTTGAATTATTAA
CTGATTGGTATTTTCATTATCTCAGTTGGGTGGTCCATCATGGACAATAGGGTTAGGGAGAAGAGATTCAACCACTGCAAGTAAAGATGCTGCCACTAGTGATATCCCATCCCCTCTAAT
GGATCTCAATGATCTCATATCTGCCTTTTCAAACAAGGGGTTTACCTCCCAAGAGATGGTAGTCCTCTCAG
GTAAATTCAAAACACTTTTTTTATTAAAAAAATCCAATTCTCAAAGACT
TCCATTGGTATCTAATTAATCAATTAATTACCTCAAATTAAGATTATGTCAACATAATAATTAATCGCATGTGGATCTAGTGCAACCTAATGGTATTTTTTTTTCTTATCTTAAAATTTG
TGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGCTCATACAACAGGGCAAGCCAAATGCCAATTCTTCCGGGGTAGGATTTACAATGAGACCAACATTGATTCAGATTTTGCA
ACATCAGCCAAGTCAAATTGTCCAAGCACTGATGGTGACAGCAACCTCTCCCCACTTGATGTCACCACCAATGTGTTATTTGACAATGCTTATTTCAAGAACCTTGTGAACAAGAAAGGG
CTTCTACATTCTGATCAGCAACTTTTCAGTGGCGGTTCTACTGATTCTCAGGTCACTACCTACAGCACTAGCTCTTCAACTTTCTATGCAGACTTTGCCAGTGCTATGGTCAAAATGGGA
AACCTCAGCCCTTTAACAGGAAGCAGTGGCCAAATTCGTACTAACTGCCGCAACGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCCATTCACTACGTTATAACGTATTTTGCTTCTCTATTTTGTTTTCTCTACTTATTGCCTTAGCCTCTGCTGAGCTATCTTCAGATTTCTATGCATCAACATGCCCCAATGCC
CTCTCTACCATAAAATCTGCAGTGAAAAGTGCAGTTGCTAAAGAGCATCGCATGGGAGCATCCTTGCTCCGTCTTCATTTCCATGATTGCTTTGTTAAT
GGATGTGATGCATCAGTTCTT
CTAGATGACACTTCGAGCTTCACGGGAGAAAAGTCAGCTGCTGCAAATTTGAATTCTTTGAGGGGTTTTGATGTAATTGACGACATCAAAAGTCAGTTGGAGAGTGCTTGTCCAGGAATT
GTTTCCTGTGCAGATATTGTTGCTGTTGCTGCACGAGATTCTGTCGTAGCA
TTGGGTGGTCCATCATGGACAATAGGGTTAGGGAGAAGAGATTCAACCACTGCAAGTAAAGATGCTGCC
ACTAGTGATATCCCATCCCCTCTAATGGATCTCAATGATCTCATATCTGCCTTTTCAAACAAGGGGTTTACCTCCCAAGAGATGGTAGTCCTCTCAG
GAGCTCATACAACAGGGCAAGCC
AAATGCCAATTCTTCCGGGGTAGGATTTACAATGAGACCAACATTGATTCAGATTTTGCAACATCAGCCAAGTCAAATTGTCCAAGCACTGATGGTGACAGCAACCTCTCCCCACTTGAT
GTCACCACCAATGTGTTATTTGACAATGCTTATTTCAAGAACCTTGTGAACAAGAAAGGGCTTCTACATTCTGATCAGCAACTTTTCAGTGGCGGTTCTACTGATTCTCAGGTCACTACC
TACAGCACTAGCTCTTCAACTTTCTATGCAGACTTTGCCAGTGCTATGGTCAAAATGGGAAACCTCAGCCCTTTAACAGGAAGCAGTGGCCAAATTCGTACTAACTGCCGCAACGTTAAC
TAA

Retrieve as FASTA