Entry information : AdelDyPrx08 (DyP8)
Entry ID 9909
Creation 2011-12-05 (Christophe Dunand)
Last sequence changes 2011-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-04-25 (Catherine Mathe)
Peroxidase information: AdelDyPrx08 (DyP8)
Name (synonym) AdelDyPrx08 (DyP8)
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelDyPrx08
start..stop
S start..stop
AdelDyPrx10 520 0 1..435 37..467
AdelDyPrx01 490 4.35e-172 1..433 71..495
AdelDyPrx07 454 1.63e-158 1..433 35..458
AdelDyPrx11 439 9.04e-152 1..429 75..493
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '9909' 'complement(join(238601..238661,238713..238983,239037..239113,239166..239267,239314..239354,239409..239704,239760..240219))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 239760..240219 458 N° 2 239409..239704 294 N° 3 239314..239354 39 N° 4 239166..239267 100
N° 5 239037..239113 75 N° 6 238713..238983 269 N° 7 238601..238661 59  
complement(join(238601..238661,238713..238983,239037..239113,239166..239267,2393 14..239354,239409..239704,239760..240219))


exon

Literature and cross-references AdelDyPrx08 (DyP8)
DNA ref. JGI genome:   scaffold_57 (240219..238601)
Protein sequence: AdelDyPrx08 (DyP8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   435
PWM (Da):   %s   47119.93  
PI (pH):   %s   5.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKKNLELFYFFTINDPKSFKVKLHNSVVPQITSAMQMLTTSSSTVTAQPMVAVNIAFADVGLKKLGITDNLNDPPYSAGQFVNADNLGDPGTKNWVKAFTLTDALHGLFIIASDDQSLVD
TEVQFLEALFGSDISKLYSLQGNIRPPPFVGHE
MFGYLDGIGQPALQGFNVNPVLPGQLVVNAGVVLVGEPGDAVLRPPWAKDGSFLAFRQLQQLVPEFDNFLLQKAPVVSGLTQQQSAD
LLGARMIGRWK
GTPVELAPLIDNPSIGPNEFQNNNFDFFNPGFPFNSDQSHCPFDAHIRKTRPRADLSAPANTIMRAGIPYGPVSPAETKAGKSSPKLERGLAFVSYQSQIAQGFQFMQQ
AWANEPSFVFGKNVAPGHDPIIGANHGNPRFMAGYNVADETQVLDLPFDFVIS
RGGAYLFSPSISALRDVISV

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAAACCTCGAGCTCTTTTACTTCTTCACCATCAACGACCCGAAGAGCTTCAAAGTCAAGCTGCACAACTCGGTCGTGCCGCAGATCACGTCCGCGATGCAAATGCTGACGACG
TCCTCCTCTACTGTGACTGCTCAACCCATGGTCGCAGTCAACATTGCGTTCGCGGACGTCGGCCTGAAAAAGCTTGGCATAACGGACAATCTGAACGACCCCCCGTATTCCGCGGGCCAG
TTCGTCAATGCTGACAACCTGGGCGACCCGGGAACGAAAAATTGGGTCAAAGCCTTCACGCTTACCGACGCTCTGCACGGGCTATTCATCATCGCAAGCGACGATCAGTCCTTGGTCGAT
ACCGAAGTGCAATTCCTCGAGGCGCTCTTCGGCTCCGACATCTCGAAGCTGTACAGCCTCCAGGGCAACATACGTCCGCCACCGTTCGTCGGCCACGAAA
GCAAGTAATATAGAAACATC
GGCGCCACCGCCGCACGCCACTGATGTCCGCACAGTGTGTTCGGGTACCTGGACGGGATCGGCCAGCCGGCTCTCCAGGGCTTCAACGTCAACCCGGTTCTTCCAGGCCAGCTTGTCGTG
AACGCGGGCGTTGTGCTCGTCGGCGAGCCTGGAGACGCGGTGCTGCGCCCTCCGTGGGCCAAGGACGGCTCCTTCCTCGCGTTCCGCCAGCTGCAGCAGCTCGTCCCGGAGTTCGACAAC
TTCCTCCTCCAGAAGGCGCCCGTCGTTTCCGGCCTTACGCAGCAGCAGAGCGCCGACCTTCTTGGTGCGAGAATGATCGGCAGATGGAAATCG
GTGCGTCATTACTCCGTGTGCTGAGTT
AAAGCAGAGCCGCTCAGTATGCTGCAGGGGGCACGCCCGTTGAACTAGCCCCGCTCATCGATAACCCTTCGTGCGTAGCTGAGCATACACCTAGTCAAGCGTTGATAATGTTGCAGAAAA
TCGGTCCCAACGAGTTCCAGAACAACAATTTCGACTTCTTCAATCCCGGGTTCCCTTTCAACTCTGATCAAAGTCATTGTCCCTTCGACGCGCACATTCG
GTGCGGGCATCTCCCGTAGA
CAAGCCTTTCTCAGCTGATGGCCGAGTGGCAGGAGAAAACTCGACCTCGCGCTGACCTGTCAGCACCGGCCAACACAATCATGCGCGCAGGCATTCCGTATGGGCCCGAAGGTAAAATAG
ATCCCATGGTATCTTCAATGCAAGCGTTTCTGAGCGTCCTACAGTCTCTCACCAGCCGAGACAAAAGCCGGCAAGTCAAGTCCGAAGCTGGAGCGCGGTCTTGCTTTCGTCTCCTACCAG
TCGCAGATCGCGCAGGGGTTCCAGTTCATGCAGCAAGCCTGGGCCAACGAGCCGAGCTTCGTATTTGGCAAGAACGTCGCGCCCGGGCACGACCCAATAATTGGCGCCAACCACGGCAAC
CCGCGTTTCATGGCGGGATACAATGTGGCGGACGAGACTCAGGTCCTCGACTTGCCGTTTGATTTCGTCATCTCCCG
GTTTGTGTGATCCCTCCTCAGCAGGACCTGTGCTGACGAAAGG
CGTAACAGAGAGGCGGAGCATACTTGTTTTCGCCATCCATCTCGGCGCTGAGGGACGTCATCTCGGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAAAAACCTCGAGCTCTTTTACTTCTTCACCATCAACGACCCGAAGAGCTTCAAAGTCAAGCTGCACAACTCGGTCGTGCCGCAGATCACGTCCGCGATGCAAATGCTGACGACG
TCCTCCTCTACTGTGACTGCTCAACCCATGGTCGCAGTCAACATTGCGTTCGCGGACGTCGGCCTGAAAAAGCTTGGCATAACGGACAATCTGAACGACCCCCCGTATTCCGCGGGCCAG
TTCGTCAATGCTGACAACCTGGGCGACCCGGGAACGAAAAATTGGGTCAAAGCCTTCACGCTTACCGACGCTCTGCACGGGCTATTCATCATCGCAAGCGACGATCAGTCCTTGGTCGAT
ACCGAAGTGCAATTCCTCGAGGCGCTCTTCGGCTCCGACATCTCGAAGCTGTACAGCCTCCAGGGCAACATACGTCCGCCACCGTTCGTCGGCCACGAAA
TGTTCGGGTACCTGGACGGG
ATCGGCCAGCCGGCTCTCCAGGGCTTCAACGTCAACCCGGTTCTTCCAGGCCAGCTTGTCGTGAACGCGGGCGTTGTGCTCGTCGGCGAGCCTGGAGACGCGGTGCTGCGCCCTCCGTGG
GCCAAGGACGGCTCCTTCCTCGCGTTCCGCCAGCTGCAGCAGCTCGTCCCGGAGTTCGACAACTTCCTCCTCCAGAAGGCGCCCGTCGTTTCCGGCCTTACGCAGCAGCAGAGCGCCGAC
CTTCTTGGTGCGAGAATGATCGGCAGATGGAAATCG
GGCACGCCCGTTGAACTAGCCCCGCTCATCGATAACCCTTCAATCGGTCCCAACGAGTTCCAGAACAACAATTTCGACTTCTTC
AATCCCGGGTTCCCTTTCAACTCTGATCAAAGTCATTGTCCCTTCGACGCGCACATTCG
GAAAACTCGACCTCGCGCTGACCTGTCAGCACCGGCCAACACAATCATGCGCGCAGGCATT
CCGTATGGGCCCGAAG
TCTCACCAGCCGAGACAAAAGCCGGCAAGTCAAGTCCGAAGCTGGAGCGCGGTCTTGCTTTCGTCTCCTACCAGTCGCAGATCGCGCAGGGGTTCCAGTTCATG
CAGCAAGCCTGGGCCAACGAGCCGAGCTTCGTATTTGGCAAGAACGTCGCGCCCGGGCACGACCCAATAATTGGCGCCAACCACGGCAACCCGCGTTTCATGGCGGGATACAATGTGGCG
GACGAGACTCAGGTCCTCGACTTGCCGTTTGATTTCGTCATCTCCCG
AGGCGGAGCATACTTGTTTTCGCCATCCATCTCGGCGCTGAGGGACGTCATCTCGGTTTGA

Retrieve as FASTA