Entry information : ZmPrx95 (GRMZM2G125698)
Entry ID 991
Creation 2005-12-16 (Christophe Dunand)
Last sequence changes 2011-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-24 (Christophe Dunand)
Peroxidase information: ZmPrx95 (GRMZM2G125698)
Name (synonym) ZmPrx95 (GRMZM2G125698)
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Apical meristems
Endosperm
Floral meristems
Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx95
start..stop
S start..stop
SiPrx57 604 0 124..472 20..371
SbPrx93 587 0 114..472 2..376
BdiPrx130 519 0 171..472 199..496
OsPrx5556 511 1e-179 170..472 206..508
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 128011530..128012177 648 N° 2 128010893..128011072 180 N° 3 127994738..127994903 166 N° 4 127994224..127994648 425
complement(join(127994224..127994648,127994738..127994903,128010893..128011072,1 28011530..128012177))


exon

Literature and cross-references ZmPrx95 (GRMZM2G125698)
Literature Lai,J., Dey,N., Kim,C.S., Bharti,A.K., Rudd,S., Mayer,K.F., Larkins ,B., Becraft,P. and Messing,J. Characterization of the maize endosperm transcriptome and its comparison to the rice genome. Genome Res. 14 (10), 1932-1937 (2004).
Protein ref. UniProtKB:   B4FSJ0 [3' end]
Cluster/Prediction ref. UniGene:   Zm.12059
Protein sequence: ZmPrx95 (GRMZM2G125698)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   472 (456)
PWM (Da):   %s   47650.39 (45995.5)  
PI (pH):   %s   8.82 (9.00) Peptide Signal:   %s   cut: 17 range:17-472
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLDLLVLSALLPFAASQSPSSLLSPAQSASRPPTAPSARPSFPSPAAPAPRLSRPPAPPAAKPSSPPPAAPAGKPSPSPRPAPTRSPAVATPAPRASPAASPAPKPSSPPPKTAPAPKPSPSVAPAPRPSPPPVTPVPPAPKPPPPPPPPPAPLQPPSNSTPTTSSALGQLSPSFYAQSCPDVELAVRDVVRSASTLDPSIPGKLLRLVFHDCFVEGCDASVLIQGNGTERTDPANLSLGGFNVIDAAKRLLEAVCPATVSCSDIVVLAARDAVVFTGGPAVPVALGRRDGLVSLASNVRRNIIDTGFSVDAMAASFTAKGLTLDDLVTLSGGHTIGSAHCNTFRERFQQVANGSMTPVDGSMNADYANELIQACSANGTVPAGTAAVGCDSGSASVFDNTYFANLLGGRGLLRTDAALVQNATTRAKVAEFAQSQDGFFASWASSYARLTSLGVKVGADGEVRRTCSSVNG

Retrieve as FASTA  
Remarks Complete sequence from 88 ESTs and genomic (chromo 10, 3 introns). Very long PS is confirmed by several ESTs. Incorrect prediction from Phytozome (exons 1 and 2 are missing due to very long intron 2) Cultivar="B73", "W22", "inbred line Mo17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGACTTGCTGGTCTTGTCGGCGCTGCTACCGTTCGCCGCCTCGCAGTCGCCGTCCTCGCTTCTGTCGCCGGCTCAGAGCGCGTCGCGGCCTCCGACGGCGCCGTCCGCGAGACCG
TCGTTCCCATCGCCTGCGGCGCCAGCGCCGAGGCTGTCACGGCCTCCAGCCCCGCCGGCCGCGAAACCGTCGTCTCCACCGCCCGCGGCGCCAGCTGGGAAGCCGTCGCCATCTCCCAGG
CCGGCTCCAACGAGGTCTCCGGCAGTGGCGACACCCGCGCCAAGAGCGTCGCCTGCAGCCTCGCCAGCTCCAAAGCCATCCTCTCCTCCACCTAAAACGGCGCCGGCTCCAAAACCATCC
CCGTCCGTGGCGCCGGCGCCAAGGCCATCTCCTCCACCTGTCACACCGGTACCACCAGCTCCAAAGCCGCCGCCACCGCCGCCGCCGCCACCGGCTCCGCTGCAGCCTCCGTCGAACTCC
ACGCCGACGACGTCCTCCGCATTGGGCCAGCTCTCGCCCAGCTTCTACGCGCAGTCCTGCCCGGACGTTGAGCTGGCAGTGAGGGACGTCGTTAGGTCGGCCTCCACCCTGGACCCCTCC
ATCCCCGGCAAGCTTCTTAGGCTGGTCTTCCATGACTGCTTCGTCGAG
GTACGGAATGGACTGTCTGAATCCCTGAATCCTTGCATTTGGGTGGGAAATAAACACCGCATTGTTGCAAAC
TGAGGGTTCTTTTGTTGTGCTCGCGCGCAAACAGTTAGTGAAATGGATGTGTGCCTGATCTAGATGATCATGCAGAGATATTTTTCGTATAAAAAAACTAGATCTAGTTTACAATTTACA
TCAAGGCGCTGGTCAGGTGCGATTCTTATCTCAGGTTTCTTTGCCCGGTGATCTTTGAAAGTGCAAGAATGGCAGGCTATCTGGTAGACTGGTAACCAAACACAAATAATACTGGGTTGC
CAAACAGCAGTGTAGGCTTTGAAAGCTTGCATTTGTGTGACTGACTGAAGGCAGCAGCTCATCTTCACTCTCTCTGCAAACTTTCTGTGTGCACGCTGACATAAATATGGCTCAGGTTAA
AGAGTGCCGATTTTCTTGATCGCAGGGATGCGATGCATCGGTGCTGATACAAGGTAACGGTACCGAGAGGACGGATCCTGCAAACCTCTCGCTTGGTGGGTTCAATGTCATCGATGCAGC
AAAGAGGTTGCTTGAAGCTGTGTGCCCTGCGACTGTTTCTTGCAGCGACATTGTCGTCCTCGCCGCAAGAGATGCTGTTGTGTTT
GTAAGTAACAGTCCAACCAGCTCAAACCTCTTGGC
TTTTTTTTCTATGCTAATAATGTACTCAAAACTGTGTGTACGCTCCAATAGCTACCTTGGTGCTGAACTTGAACATGGAACATCTCGTACAAACAATAGTACCAATCTTAACTACCTAGC
TGAACATAGGCCAACACAGAATCTCGCTAATAAATGCTTAAGGGATTAGATCTCTACGCCATCAATGATTGATTGTTCCTGGCCCCATATATATATATATATATATATATATATATATAT
ATATGGTACGATGTGAGTGTGACCAAACATCTGCATGATATAGATTGCATACTAGGATTAGAATATAAACTGGTATACGTTGTGTAAAGAGTGATGAATAGTTTTTACCAACTTCAAACT
TGAATTGGTGGAGCACCTTTTGATGAGTTCCATCAAAAAGGTGAATTTGGGGAGATTCACTAATTTGGTTGATCTAGATCTCATGAATTTGTACCTTTTTATCAATTTTTTTCTAGAGGG
AAGCTGTTTTTATAAAACAGAAGTTGGTGGAGCTGTTCCAAACACATTCTTAGACACAAATACATAATGGGACAGGTATAGAGACACGTGCACGCTTTAGCATGTCCCAAAGTCAACATA
ATTCTGTTTCCAGTAATTAGTCTCGTGTCTAACAAATAGCTATCTAAAGAGCATCTTCAAGAGAGGCTTTAAACATGGTCCTATTTTAAATATAGGGTTTAAAACAATAAAATATCTTTC
TAACAACGGCCCTATTTTATAAAATTTCATCGAACGATTATAGGGCTCGGTCTCTCGGATCATAAATATAGTATACCGTATACTGGAGCTCTATCTTCATTTTCACTTTGTCGGCGTTTC
GAGACAGGGGGGTCCCTAAGCCGACGAGTGAGTGTGCTGCGTGCCCCAGCCCAGATGGGTCGAGCGCGTGGGCGAGCGCGGAGGGGGGAGAGGCGAGGCGGCCGGAGCCGAGCGTGAGAG
AGGTGGAAGTCCCGCGGCCTTCGTGTTCGTCCCGCGCCCAGGTCGGGTGCGCTTGCAGTAGGGGGGTTACAAGCGTCCACGCGGGTGAGGGAAGCGAGCGGCCCCAAGAGAGCGCCTGTC
CCGTCCTCGGTCCCGCGCGGCCAACCTCCTCTGAGAAGGCCCTGGTCCTTCCTTTTATAGTTGTAAGGAGAGGATCCAGGTGTACAATGGGGATGTAGCAAAGTGCTACGTGTCTAGCGG
GGGGGAGAGCTAGCGTCCTATGTACATGCGATGTGGCAACCGGAAAAGATCCTGGGCATCCTGCTGGCGTGGTAGTCGTGGTCTATCGGAAAGTGCCGCGGAAACTTGCTGATGGACAGC
CTGTCGATAGATTCCACTCTCCGTGACCGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNCAGCTGTTCCTCATGGGATCCGGGACATGAATTAGAGTCAGTTCAGATGATACGACCGTCATCGTTTAGCCATGCTCTTCCGAAACCCGAGGAATCGTTTCCATTGCTT
CCAGGGCCGAACCCCAACCCGGGGGGTCGGGCGAACGAAAAGTAGTCCGGGCGGAGCCAGGGCGGAGTCCGAGCCCTGGGGTCGGGCGAGGCGGATCTTTGTCGTCTTCCGGGTCTAGCC
CGAGTCCGAGCCCTGGGGTCGGGCGGAGTGGAATTCGCCGTCTTCCGGGTTTTAGCCCGAGTCCCGAGCCCTGGGGTCGGGCGGACCGGAGTTCGCCCGTCTTCCGGGTCTTAGCCCGAG
TCCGAGCCCTGGGGGTCGGGGCGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCTCCGTCTTCCGGGTTTAGCCCGAGTCCGA
GCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTGGCGCCTTTGGCAAGGCCTAATTGCCTGTCA
GACTCACTCTGTCGAGTGGCACTGCAGTCGGAGTGGCGCAGGCGGCGCTGTCCTTCTGTCAGACTGGCCAGTGGAGCGGTGGAGTGACGGCGGTCACCTCGGCTCTGCCGGGGGCGCGTG
TCAGGATAGAGGTGTCAGGCCACCTTTGCGTTAAATGCCCCTGCAATTTGGTCAGTCGGTGCGGTGATTTAGTCAAGGTTGCTTCTGAGCGAAGCCAAGGCCTTGGGCAAGCCGGTGATG
TGTCCGCCATAAAAAGGGGGGCCTCGGGCGAGATGGAAGTCTCTCGAGGTCGGCTGCCTTCGGCCGAGGCTAGGCTCGGGTGAAGCGTGATCGAGTCACTCGTGTGGACTGATCCCTGAC
TTAATCGTGCCCATCAGGCCTTTGCAGCTTTATGCTGATGGGGGTTACCAGCTGAGAATTAGGCGTCTTGAGGGTACCCCTAATTATGGTCCCCGACAGTAGCCCCCGAGCCTCGAAGGG
AGTGTTAGCACTCGCTTGGAGGCTTTTGTCGCACTTTTTTGCAAGGGGACCAGCCTTTCTCGGTTGCATTTCGTTCCGGTGGGTGCGCGCGAGCGCACCCGCCGGGTGTAGCCCCCGAGG
CCTCGGAGGAGTGGTTACACTCCTTCGAGGTCTTAATGCTTCGCTTTACGCTTCGGCTGGTCTGGTCGTTCCCTCATGCGAACTGGCCGTAGCCCGGGTGCACGGTCGGGGCCCAAGCTC
TCGGGCTGGTATGTTGACGCTGTCAACGATTTGGCCGGAGCCGGTTTTTGCGAGAGCAGCCCCCGAGCCTCTGCACAGGGCGAGAGGACGATCAGGGACAGACTCGGCTTTTTACATACG
CCCCTACGTCGCCTTTCCGCAAGGAGGAGGGGGGGAGTGCGCCATGTTACCCTCGATGGGCACCGAACATGGTGTCTCCGGTGAGCTGCAAGCGGGTAATCCGAGTGGACGTCCGTGCCC
CGTTCGTTGGGGGTCGGCTAGGGGCCCAGAGGCACGCCCAAAAGTACCTGCGGGTGATTTGCCGGACCCGGTCCCCTGGCGACGGGGTCCGAGGGCTCGATGCCTCCCTCCGATGGGATT
CCGTTACAAGATCGTTCCCGCTGGTCTCGGAAATGTCCTAGGGTACCTCGGGAGCGCAGCCCGAGCCTCGGTTATGTATCGAACGTACCCCTGGTCATCCCTCGCTCGGTGTCTGAGGCC
ACTGTGAACCCTTCGGGGGCCAGCCTTCGAACCCCTGATCAGTAATGGGCGCGGAGCCCGAGTAGCCTGAGGCGGCCATGGAGCCCTTCGGGGGGCTGGCCTTCGAACCCCTGACCAGTA
GTGGGTGTCGGGCCCACGCGATCTGAGGCGACTGTTGAACCCTCGGGGGGCCAGCCTTCGAACCCCTGATCAGTAATGGGGGGCTCGGAACCCGGTTCCTTCGCGGAAAAGGATCCCTTT
CGGGGTACGGTCTTTTCCCCCTCCCTGTTGCAAGAATAGAAAAAGAAAAAAAAGAAAAAAATACGAAATCGGACGAACAGGCGTACGAAAAATAACGCGGGCATTGCTTTTTTGGGTTAA
GCCTCGGTTGCTCCTCCAACGGCGAAACGCCGGAAAAGCCCGCGCGGCCCTCCCCCCCCCGGGCCCTGGCCCCCAAAGGGACGGGCCCCCCCCCCGGTTGCCAATCCCCCCCCCCCCCCC
CCCCGGCCACCCGTCTTTCCCCCCCGGGGAAAGGAAGGCTCTTCTTTGCTGTTTTCAAGGAATGGGGAACGGTGAAGCCCTGGGCTGAAAAAAAACGGGGACCCCCCCTTGCCCCCCCCC
CCCCCCCCCCCCTGGCCCCCCCCCCCTTAATTTTACCCTGGCCCCGGGCCCCCCCCCCTTTTTTTTCCGGGGTCCCCCCTTTTTTTTTAACACCCCCAAAATGGTGCCGCCCCCCCAAAG
TTCTTCTTTGGGGGGGGCCGCGCCGTTTGTTTGTTTGTGGGGGGGGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCGAAGCCAAGGCGTCGGGCAAGCCGATGATGTGTCCGCCATAAAAGGGGGGCCTCGGGCGAGACGGAAGTCTCTCGAGGTCGGCTGCCT
TTGGCCGAGGCTAGGCTCGGGTGAAGCGTGATCGAGTCACTCGTGTGGACTGATCCCTGACTTAATCGTACCCATCAGGCCTTTGCAGCTTTATGCTGATGGGGGTTACCAGCTGAGAAT
TAGGCGTCTTGAGGGTACCCCTAATTATGGTCCCCGACAGTAGCCCCCGAGCCTCGAAGGGAGTGTTAGCACTCGCTTGGAGGCTTTTGTCGCACTTTTTTGCAAGGGGACCAGCCTTTC
TCGGTTGCATTTCGTTCCGGTGGGTGCGCGCGAGCGCACCCGCCGGGTGTAGCCCCCGAGGCCTCGGAGGAGTGGTTACACTCCTTCGAGGTCTTAATACTTCGCTTAACGCTTCGGCTG
GTCTGGTCGTTCCCTCATGCGAACTGGCCGTAGCCCGGGTGCACGGTCGGGGCCCAAGCTCTCGGGCTGGTATGTTGACGCTGTCAACGATTTGGCCGGAGCCGGTTTTTGCGAGAGCAG
CCCCCGAGCCTCTGCACAGGGCGAGAGGACGATCAGGGACAGACTCGGCTTTTTACATACGCCCCTACGTCGCCTTTCCGCAAGGAGGAGGGGGGGAGTGCGCCATGTTACCCTCGATGG
GCACCGAACATGGTGTCTCCGGTGAGCTGCAAGCGGGTAATCCGAGTGGACGTCCGTGCCCCGTTCGTTGGGGGTCGGCTAGGGGCCCAGAGGCACGCCCAAAAGTACCTGCGGGTGACT
TGCCGGACCCGGTCCCCTGGCGACGGGGTCCGAGGGCTCGATGCCTCCCTCCGATGGGATTCCGTTACAAGATCGTTCCCGCTGGTCTCGGATATGTCCTAGGGTACCTCGGGAGCGCAG
CCCGAGCCTCGGTTATGTATCGAACGTACCCCTGGTCATCCCTCGCTCGGTGTCTGAGGCGACTGTGAACCCTTCGGGGGCCAGCCTTCGAACCCCTGATCAGTAATGGGCGCGGAGCCC
GAGTAGCCTGAGGCGGCCATGGAGCCCTTCGGAGGGCTGGCCTTCGAACCCCTGACCAGTAGTGGGTGTCGGGCCCACGCGATCTGAGGCGGCTGTTGAACCCTCGGGGGGCCAGCCTTC
GAACCCCTGATCAGTAATGGGGGGCGCGGAGCCCGGTTCCTTCGCGGAGAAGGATCCCTCTCGGGGTATCCCCCTTCCCCGGTCCCTGTTGCAAGAGATAGAGAAAGAGGAAAACGGAAA
AGGATACGAAATCAGACGACGTGGCGTACCTTTTCTGACGCGGTTATTAAGGCGAGGGTGAAGCGTCGCGCGCTCCTCCTGCCAAAAGCGCCGCGTGTCCCGCCGCGGAGTTAATGCGAC
GGGGCGAGTGGTTGGCTGGGCGGCCGCTACGCGTGTGCGATCCGTTCGAGGAACGGGTCACGGGTGCACCGTCTTCACGCCGTGAGAGGAGGCTCTCTTGCTGTCTCAGGATGGGACGTG
AGCCTGGCTGACGACGCGACCGCTGCGCCCGCCCGCCTGCCACCGCCATTACTGCCGGCCCACTTTCGGTCGCTTTGACCGACGCGCCAGTCTGGCGCTGTTGGGTCGCCTCGAGTCGTG
GCATAGGCTTCGCAACCGAAGAGGCGCGATGATGGCACAAGTAGCGGTGCAGTTGCTTGCATGCAGCAACTGGCGTGCCGGTTGCTCGACGCGTGGGCCTGGATCCCAGGCTGGCGTGTC
AGAAGTTGGAGAAGCGCGCCCATCTGGCGCGGTTGCATGCCGCCTGCATGGCTGCTCGCCCCTTCTGCCCGTTGGTCTGGGCGAAAATGGGGGTCGCCTGTAACCGCTGGACGGTCGTGC
GCACCATGCGCGGCGGTTTGGCTTCTTCTGCCCTGAGCCGGCTTGTATGACATGCGGGACCCAGCCCCCGAGTCGCAGGGGAGGGCCTTGGAGCGTGTCGGAGAAGACCCGGCCCGCGGC
GCTTGGGGGCGCACGTAGGGGGAGTTGCCTTTAAAAGGAGGGAGGCTCCCTTCGTAAGGCAACCATGTCTTCTTCCTCCCTTAAGCGCCGGGTCTTCCCGTCTTCCAAGCCCCCGGATGG
GGGATATCCGCCGCCTTTCCGCCTCCTCGTTGGAGGAACGCGACTCCATGGGAGTTGGTACCTCTCAGCCATCGTTCGGCTTCAAGGATTTTCATCGGCCGGCCCGGCCGTACCCCCATG
CCGACGATCACCCAGGATGGTGACCGCCGGTTTCTAGGTGGGGAAGAGCAAGCCAGGCTGCAATCTTGGTCCCACCCTCAGCTTCAAGGATGTTCATCATCCCAGCTGGGGCGGGAGTCA
TGCCGAGCCGGCGCTCTACCTTCCGCGCGGGTCCGCGGGTCGCCCCTTCCCACGGCGTTTGGGGGTGGAGGCGCTCGCTGGCCCTGCGGACGGCGCGGACTTCGATAACGAGGGGCTGAA
CGACGGCGGGCGTCGTCACCTCCAGCGTGTCGGAGTCGTCGGCCGGGCTTCCGGCGGCCCCTCCTGCCGGAGGGTGGGCGCCGCATCGTGTGCATAGGAGGACCACCCAGGATTCCTCGC
GCCTTTAGGGCGGCGTTCGTGTTCTGGGGTGGTCCTGCTTTTGCACTGGGACGGCGGCCTTGCGCAGTGGCCGGCGCCCCCACTCGTCCGGGAGGATTTGAGTGGGGATCTGCCGGGGGG
CTGGTGCCCCCTGCCATCGGCGCCGGTGCGGAGGCGGCTCGAGAAGTCCTCGTCACCGACGGGATCACTGCCACCGCCCGCGCCCCGGGCCACCGCGCCGGCGTGCTTGTCCTCGCCCCT
CGAGCGTCGGCGGGGGCGGGGACAAGACCGCAGCAGCGCCGACCCACTGTTGCCGCAGTCAGGACGGGCGGCGGCGAGCCAGCCATCGGTCTTCTGTGGCTCCGCAGGCCTTCCCCATGG
AGTGGGGTCGTTCGTACCTGCGGAGGGGGGAACCGGAGTTCCGTTGGTAGTGGCATCTCGTATGCCAGTGAGTTCGTTCATTGTGGCTGTCGGGGCCTGAACGTGTATGTAATTTTGGCA
CGGAGCCGTGTTTTTTCCTCATTTCCGAGCACTAAGTCTCGCCTGTTTTATTATCTGAACCGCTTTACCAAGCATGAGTTGCCCCGTGTCAAGGTGACGGGTGAGGTATCCGTATCCCGG
AGGCGTAGGAATCCCTCGGCCCGTTCGGCCTTGTTACGTGAGGCTCCTCTAGCTTAGTTGAAGGGACCCCTCGGCCGCCCTTTGGTGGATCGAGGCCGGGGGTAGCGATATCAGTATGAA
CAGAGGCGGAGTTGGCTCGAGAATGGGGAACCTGGTTGGCCGGAGCCTAGCCGTGTCGCCCGTCAGCGGTGCCGACGCCCAAGTCGGTCAGTCGAGGCCTCGGATCGGGCTAGCGCCCTT
GGAAGCCGGTTGCCCGAGGCCCCAGGGGTAACCGGTTGAGCCGCCTGCTCGGGCCGGATTCCCGGAGGAGCCCCTGGACCTCGGCGCCGCCCGAGGCTGGGTCGGGCTTTGTTGTAGACG
TCGTCGATGCCGAGGGTGCTACGGCTCCCTTCGGCGTGAAGACCCGAGCCTGCAGGATCAGATCGTCTTGTAGCGTGTGTTTTCTGCGGCCGCCGAGGCCAGAAGAACACGCCCTCGCCG
CGCTTGCGAAGCTGCGTCCTTTTTTCCTCTTGTTTCGAGCATCTGGACTCTGTCGGTAATAGGGATGTTTGTGTGAGAGTTGCTTTTCGCGGTAGGGACGAGTGAGGTATCCGTATCCCA
GAGGCGTGGGAATCCCTCGGCTCGGTCGGCCTTGCCGCTTACGCGTACTTTCACCCGTCCATGAGGCCCTGTCCCCGATTTAGTCGAGAAAGCTTGAAGGACTGCTTCGGCAGGAGAGCT
TCCGAACGTGATGACTCGTTCGGTCCACGGAGTCGCTTTATCCGAGCGCAAGTTACTTATCGCAGAAGGGGACGAGTGAGGTATCCGTATCCCGGAGGCGTAGGAGTCCCTCGGCTCGGT
CAGCCTTGGCTGCTTACGTGTACCTCGTCGTTTCCAGGATCCGCTTTCCAAAGTAGTCAAGAAGCACGGAAGAAATCCTGCTAAAAAGAGGTCCTTTTTCGAGGAAAAAATTCAACGCAG
AGGGGGTCTCCCCCCTTTTAGCCCCCGAGGGAGGGTCGGGCCTTGCCGAGGCTAGGCCGACCCTTCCTTGACAACTAAACTTTGCGTAGGTGCGAGGTATATGAACAACTTGAAAACATC
TTAAGGGTAGAAGCGACGTAGCTGTTTGATGTTCCAAGCGTTGCCGTAGATCTCGCCTTGATTGTTGGCCAGCTTGTATGTTCCGGGCTTCAGAACTTTGGCGATGACGAACGGCCCTTC
CCAGGGGGGCGTGAGCTTGTGCCTCCCTCGGGCGTCTTGTCGCAGCCGAAGCACCAGGTCGCCCACCTGGAGTTCTCGGGACCGGACCCCTCGGGCGTGGTAACGTCGCAGGGACTGTTG
GTACCGCGCCGAGTGTAGTAAGGCCCTGTCCCGAGCTTCCTCCAACTGGTCCAGCGATTCCTCTCGGCTGGCTTGGTTGCTTTGCTCGGTGTAGGCCCTCGCCCTTGGGGAGCCGTATTC
CAGGTCAGTGGGCAGGATAGCTTCAGCCCCGTAGACCAGGAAAAACGGCGTGAAGCCCGTGGCACGACTCGGCGTCGTCCTTAGGCTCCAGACCACCGAGGGGAGTTCCTTCATCCATCG
CCTGCCGAACTGGTTGAGGTCGTTGTAGATCCGAGGCTTGAGCCCCTGTAGAATCATGTCGTTGGCACGCTCTACTTGCCCATTTGACATGGGATGAGCCACGGCGGCCCAGTCCACCCG
GATATGATGATCCTCGCAAAAATCCAAGAATTTTTTGCCGGTGAACTGGGTGCCGTTGTCGGTGATGATGGAGTTCGGGACCCCGAAGCGATGGATGATGTTGGTGAAGAATGCCACCGC
CTGCTCGGACCTGATGTTGTTCAGAGGTCGGACCTCGATCCACTTGGAGAATTTGTCGATGGCGACCAGCAGGTGCGTGTAGCCCCCGGGCGCCTTTTGCAAGGGACCGACGAGGTCCAG
ACCCCACACAGCGAAGGGCCAGGTGATGGGTATTGTCTGCAGAGCCTGAGCGGGCAGGTGTGTCCGCTTCACATAGAATTGGCACCCTTCGCAGGTGCGGACAATTCTAGTGGCGTCAGC
CACCGCCGTTGGCCAGTAGAAGCCTTGCCGGAAAGCATTTCCAACAAGGGCTCGGGGTGCTGCGTGGTGGCCGCAAGCCCCCGAGTGTACTTCTTGCAGCAGTTCCCGACCTTCGGCGAT
GGAGATGCATCGCTGGAGGATGCCCGAGGGGCTGCGATGGTAGAGCTCCTCTTCGTCGCCCAGCAAGACGAATGACTTGGCGCGTCGCGCTACACTCCGAGCCTCGGCTTGGTCGAGGGG
TAGCTCTCCTCGGCGGAGATATTGCAGGTACGGGGCCTGCCAATCTTGGTCTGGCGTGGCCCCGCTCTGCCCTTCCTCGACGTTCAATGCCCCGCCCTCGGGGGCCGAGGGTACCTCGGG
CCGGGCCGAGGTTGGCTCGGGCTGAGCCGAGGGTACCTCGGGCTGAGCCGAGGGTACCTCGGGCTCGGGCGCGTCGTCGAGCTTGACGGAGGGTTGATGCAGATCCCGGGAGAAGACGTC
CGGGGGGACTGTCGTTCGTCCCGAGGCTATCTTCGCCAGCTCGTCTGCGGTTTCGTTGTAGCGCCGAGCGACGTGGTTGAGCTCGAGCCCGAAGAACTTGTCTTCCAGGCGCCGGACCTC
GTCGCGGTAGGCCTCCATCTTTGGGTCGCGGCAGTGGGAGTTCTTCATGACTTGGTCGATGACGAGCTGCGAATCACCGCGGGCGTCGAGGCGTCTGACCCCTAGCTCGATGGCGATCCG
CAATCCGTTGACCAGAGCCTCGTACTCGGCCACATTGTTGGACGCCGGGAAGTGGAGGCGCAGCACGTAGCGCAAGTGCTTTCCGAGGGGCGAGATGAAGAGCAGGCCTGCACCGGCCCC
CGTCTTCATCAGCGACCTCGAGGGTGTGCTTGACGGGCCCCTGATGGTAGGGGCACGGCTCCTTGAGCATCTTGTCGAAGAGGTTTGCACCTCCGGGGGGCTTCCGAGGGTTCTTATACT
CGGCGGCGGCGACAAGGTCCGCGTCTGCGGCGTCGCGTTTCGATTGCGACTTCTTCTTGCCTTTCTTCTTGGCGCCGCGCGGAGCAGACGTCTCGGGAGCTTCTTCCGACGGGCGGCCCT
GGGGCTGCTTGTCCTTTCGGAAGATAGCCTCGACCGCCTCCTGGCCGGAGGCGAACTTGGTGGCGATGTCCATCAGCTCGCTCGCCCTGGTGGGGGTTTTGTGACCCAGCTTGCTCACCA
GGTCGCGGCAAGTGGTGCCGGCGAGGAACGCGCCGATGACATCCGAGTCGGTGATGTTGGGCAGCTCGGTGCGCTGCTTCGAGAATCGCCGGATGTAGTCCCGGAGCGACTCCCCCGGCT
GTTGCCGGCAGCTTCGAAGGTCCCAGGAATTCCCGGGGCGCACGTATGTGCCCTGGAAATTGCCAGCGAAGGCTTGGACCAAGTCGTCCCAGTTGGAAATCTGCCCCGGAGGCAGGTGCT
CCAACCAGGCACGAGCAGTGTCGGAGAGGAACAGGGGGAGGTTGCGGATGATGAGGTTGTCGTCGTCCGTTCCACCCAGTTGGCAGGCAAGGCGGTAGTCCGCGAGCCACAGCTCCGGTC
TCGTTTCCCCCGAGTACTTTACGATAGTAGTCGGGGGTCGGAACCGGGTCGGGAATGGCGCCCGTCGGATGGCCCGACTGAAAGCCTGCGGACCGGGTGGTTCGGGCGAAGGACTCCGAT
CCTCCCCGCTGTCGTAACGTCCCCCACGCCTGGGGTGATAGCCTCGGCGCACCCTTTCGTCGAGGTGAGCCCGACGGTCGCGTCGATGGTGCTCGTTGCCGAGGTGGCCCGGGGCCGCAG
GCGCGGTGTTGCGCGTGCGCCCGGTGTAGACCGAGGCTTCCCGCACGAATCGGGAAGTCGCGACATGAGGTTCCGAGGGATATCCTTGCCCTTGGGATGCAGTGCTCTCGGCCCGCCGGG
CCGCGGCGCCTTCCAGGAGATTCTTGAGTTCTCCCTGGATCCGCCGACCCTCGGTGGTTGACGGCTCCGGCATCGCGCGGATGAGCATTGCTGCGGTTGCCAGGTTCTGACCGACCCCGC
TGGATGCGGGCGGCGGCCTGATCCTGACGTCGTTGGCGACGCGGTGCTGGAGACCTTGGGGCAGATGACGTATTTCTCCGGCCAGGGGTTGGCCCACCCATGCCTGTCCGACGTCCCGAC
GGATCGGCTCAAGCGCTCCCGTTCCCTCGTTGAGCCTGGCCTGCGCCTCGCGGACTTGCTCGAGTTGTGGGTCGTAACCCCCCGCCGGAGCGGGGACCACAGCTAGCTCCCGTGGGATGT
CAGCGCGAGGCACCGGCCTAGGGAGATCACCATCCTCCGGCATGCCAAGATGGTTGCCTTCGGTGGGATTCCCTAGCTCGATGTGGAAACATTCGCGGCTTGGGCCGCAGCTCTCGTCGC
CAAGGCTGCGGCTTCCATCGGAACAGTCGGACAGACAGTAGTCACATGCGGCCATGAAGTCCTGCACGGCACTGGGGTTGCCAAGTCCGGAGAAATCCCAACCGATGCTGGGGTCGTCAT
CTTCCTCGGACCCAGAGGGCCCGTAGGTCGAGACGTCCGTCAGTCGGTCCCAAGGCGATCGCATACAGAACCTCAGTGGGGTTGCACTCGCCTCAATGAGGACGCCCGCCAAAACGAGGT
CGTTTGGCGGGTGGAGGCCGAGTCGAAATGACGCAAGATGGGAGTCAGTCGTTACCTTTTGGTCGACGAGGAGCGACGTAGTCACATCGGGGACTGGTTGCGCCGTCATCTCTGGTTCGA
GGGCGACGTCCTGCAGGCTTTCCGCGAGCGCGCCGGCGTCGTCTTCTTGCTCGGGGTCATCGTGCCGCGGGGGGACGGCGCTTGCCTCCGTCTTGAACGCGAGGTCGATGTCCGGCGTGC
CTTCCGTCGGGGCGTCGGGGGCGTCGATTCGCTCGACGGCCGGCGAAGCGTGGCCTCCCGTCTGGCCTTGACGGCTCCGCCTTCCCCTCCGTTGGCGGGGGAGAGAACGGAGCGAGCCCG
AATATAGCTCTTCCACCACGCGGGGAAGACGTCGTCGATTCCGCCGCCGGCGGGCGGGTTGTCGGCCGCCATTGTCGTGGTCGCACGGCGGTGGAAGAAGTATCATGTCGTAGCTGCCGT
CGAAGGACATGAACTCGAGAGCCCCGAAACGAAGCACCGTCCCGGGCCGGAGAGGTTGCTGGAGACTGCCCATCTGGAGCTTGACGGGGAGCTATTCGTCAGCACGCAGCAGGCCCCTAC
CTGGCGCGCCAACTGTCGGCGTTTCGAGACAGGGGGGTCCCTAAGCCGACGAGTGAGTGTGCTGCGTGCCCCAGCCCAGATGGGTCGAGCGCGTGGGCGAGCGCGGAGGGGGGAGAGGCG
AGGCGGCCGGAGCCGAGCGTGAGAGAGGTGGAAGTCCCGCGGCCTTCGTGTTCGTCCCGCGCCCAGGTCGGGTGCGCTTGCAGTAGGGGGGTTACAAGCGTCCACGCGGGTGAGGGAAGC
GAGCGGCCCCAAGAGAGCGCCTGTCCCGTCCTCGGTCCCGCGCGGCCAACCTCCTCTGAGAAGGCCCTGGTCCTTCCTTTTATAGTTGTAAGGAGAGGATCCAGGTGTACAATGGGGATG
TAGCAAAGTGCTACGTGTCTAGCGGGGGGAGAGCTAGCGCCCTAGGTACATGCCGATGTGGCAGCCGGAGAGATCTGGGCATCCTGCTGGCGTGATGTCGTGGCTATCGGAGGTGCGGCG
GAGCCTGATGGAGGGACAGCTGTTGGAGCGGTCGAGTCCCTGCTGACGTTGTCCTGCTGCCGTAAGAGAGCTGGGGGCCGCCGTCGTCATAGAGCTCGTGGAGCGCCATCATTGCCCCTC
TGGCGGAGCTGGCCGGACGAGACGCCGGTCTTGTTCTCCGTGACCCGAGTCGATTCGGGGCAGGATGATGATGACGTTTCCTGTTGATGTGGCGGTCTGTGCTCTAGGAAGGGCGACGTG
GGGTTTCCTCCGAAGCCGAGGTTGAGTCTGCCTTCTGCTGCCGTGGCCGAGCCCGAGCCAGGGGGTCGGGCGAAGCGGAAGTCGTCCGGCCGAGGCCAGGGCGGAGTCCGAGCCCTGGGG
TCGGGCGAGGCGGAGTTTCGTCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGTGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGG
CGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGGTCGGGCGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAG
CGGAGTTCACCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGT
TCGCCGTGGCGCCTTTGGCAAGGCCTAATTGCCTGTCAGACTCACTCTGTCGAGTGGCACTGCAGTCGGAGTGGCGCAGGCGGCGCTGTCCTTCTGTCAGACTGGCCAGTGGAGCGGTGG
AGTGACGGCGGTCACCTCGGCTCTGCCGGGGGCGCGTGTCAGGATAGAGGTGTCAGGCCACCTTTGCGTTAAATGCCCCTGCAATTTGGTCAGTCGGTGCGGTGATTTAGTCAAGGTTGC
TTCTGAGCGAAGCCAAGGCCTTGGGCAAGCCGGTGATGTGTCCGCCATAAAAAGGGGGGCCTCGGGCGAGATGGAAGTCTCTCGAGGTCGGCTGCCTTCGGCCGAGGCTAGGCTCGGGTG
AAGCGTGATCGAGTCACTCTTGTTGTCTATCCCTGACTTAATCGTGCCCATCAGGCCTTTGCAGCTAACGAATTCAAGCTTGATTTCATAAGGGAAGTTAAANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTCGGGGGGCAAAACCTTGGAGGATCCTTCTGTCTA
GCTTGGGGAGAGCTAGCGCCCTAGGTTCATGCCGATGTGGCAGCCGGAGAGATCTGGGCATCCTGCTGGCGTGATGTCGTGGCTATCGGAGGTGCGGCGGAGCCTGATGGAGGGACAGCT
GTTGGAGCGGTCGAGTCCCTGCTGACGTTGTCCTGCTGCCGTAAGAGAGCTGGGGGCCGTCGTCGTCATAGAGCTCGTGGAGCGCCATCATTGCCCCTCTGGCGGAGCTGGCCGGACGAG
ACGCCGGTCTTGTTCTCCGTGACCCGAGTCGATTCGGGGCAGGATGATGATGACGTTTCCTGTTGATGTGGCGGTCTGTGCTCTAGGCAGGGCGACGTGGGGTTTCCTCCGAAGCCGAGG
TTGAGTCTGCCTTCTGCTGCCGTGGCCGAGCCCGAGCCAGGGGGTCGGGCGAAGCGGAAGTCGTCCGGCCGAGGCCAGGGCGGAGTCCGAGCCCTGGGGTCGGGCGAGGCGGAGTTTCGT
CGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGTGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTCTT
CCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTCTTCCGGGTCTTAGCCCGAGTCCGAGCCCTGGGGTCGGGCGGAGCGGAGTTCGCCGTGGCGCCTTT
GGCAAGGCCTAATTGCCTGTCAGACTCACTCTGTCGAGTGGCACTGCAGTCGGAGTGGCGCAGGCGGCGCTGTCCTTCTGTCAGACTGGCCAGTGGAGCGGTGGAGTGACGGCGGTCACC
TCGGCTCTGCCGGGGGCGCGTGTCAGGATAGAGGTGTCAGGCCACCTTTGCGTTAAATGCCCCTGCAATTTGGTCAGTCGGTGCGGTGATTTAGTCAAGGTTGCTTCTGAGCGAAGCCAA
GGCCTTGGGCAAGCCGGTGATGTGTCCGCCATAAAAAGGGGGGCCTCGGGCGAGATGGAAGTCTCTCGAGGTCGGCTGCCTTCGGCCGAGGCTAGGCTCGGGTGAAGCGTGATCGAGTCA
CTCGTGTGGACTGATCCCTGACTTAATCGTGCCCATCAGGCCTTTGCAGCTTTATGCTGATGGGGGTTACCAGCTGAGAATTAGGCGTCTTGAGGGTACCCCTAATTATGGTCCCCGACA
CACTTAATCTCCACTATTTATTTCCAAATAATATAATTTATTTCCTAAATAGCATTATTTAAGACTTGACTGTTGGAGTAAGCATTTCTTTTGAGATCCTAAAAATTTCAAATACCTATT
TCAAATTTTAGGACTCTACTTTAGGGTTTGTTGTTTGAGATGCTATAACTATTAGCTAATTTGTTAAAAGTAGTTGATAGTTGAACTATAAGCTAGAATGTTTGGATGTTTTTAGCTAAT
TTTAGTGGCTAACTATTAGTTATAGTGCATTGAAACATGACCTTAGTCCCATAACAAGTTTGAATAATCCGCTGAGATGCTTGTGTGTGTATGGGATTTTTGTTCCAAAACCAGACTGGA
GGACCGGCTGTGCCTGTCGCGCTGGGAAGACGAGACGGCCTCGTCTCGTTGGCATCCAACGTCCGAAGAAACATCATCGACACGGGCTTCTCCGTGGACGCCATGGCGGCCAGCTTCACC
GCCAAGGGGCTCACCTTGGACGACCTCGTCACTCTCTCAG
GTAACAGACGAAAGCTGCAGCTGCTTTGTTTGAGTAACGCGAGCTGTGGACGCATCGCATCTCACCGACGGCTTTGCGCG
CGCGCGCAGGGGGGCACACCATCGGGTCGGCGCACTGCAACACGTTCCGGGAGCGGTTCCAGCAGGTGGCGAACGGGAGCATGACGCCGGTCGACGGGTCGATGAACGCCGACTACGCGA
ACGAGCTGATCCAGGCGTGCTCGGCGAACGGCACCGTGCCGGCGGGCACGGCCGCCGTGGGCTGCGACTCCGGCTCGGCGTCCGTCTTCGACAACACCTACTTCGCGAACCTGCTGGGCG
GGCGGGGCCTGCTGCGCACGGACGCCGCGCTGGTGCAGAACGCGACGACGAGGGCCAAGGTGGCGGAGTTCGCGCAGAGCCAGGACGGCTTCTTCGCGAGCTGGGCCAGCTCGTACGCCA
GGCTCACCAGCCTCGGCGTGAAGGTCGGCGCCGACGGCGAGGTCCGGCGGACCTGCTCCAGCGTCAACGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGGACTTGCTGGTCTTGTCGGCGCTGCTACCGTTCGCCGCCTCGCAGTCGCCGTCCTCGCTTCTGTCGCCGGCTCAGAGCGCGTCGCGGCCTCCGACGGCGCCGTCCGCGAGACCG
TCGTTCCCATCGCCTGCGGCGCCAGCGCCGAGGCTGTCACGGCCTCCAGCCCCGCCGGCCGCGAAACCGTCGTCTCCACCGCCCGCGGCGCCAGCTGGGAAGCCGTCGCCATCTCCCAGG
CCGGCTCCAACGAGGTCTCCGGCAGTGGCGACACCCGCGCCAAGAGCGTCGCCTGCAGCCTCGCCAGCTCCAAAGCCATCCTCTCCTCCACCTAAAACGGCGCCGGCTCCAAAACCATCC
CCGTCCGTGGCGCCGGCGCCAAGGCCATCTCCTCCACCTGTCACACCGGTACCACCAGCTCCAAAGCCGCCGCCACCGCCGCCGCCGCCACCGGCTCCGCTGCAGCCTCCGTCGAACTCC
ACGCCGACGACGTCCTCCGCATTGGGCCAGCTCTCGCCCAGCTTCTACGCGCAGTCCTGCCCGGACGTTGAGCTGGCAGTGAGGGACGTCGTTAGGTCGGCCTCCACCCTGGACCCCTCC
ATCCCCGGCAAGCTTCTTAGGCTGGTCTTCCATGACTGCTTCGTCGAG
GGATGCGATGCATCGGTGCTGATACAAGGTAACGGTACCGAGAGGACGGATCCTGCAAACCTCTCGCTTGGT
GGGTTCAATGTCATCGATGCAGCAAAGAGGTTGCTTGAAGCTGTGTGCCCTGCGACTGTTTCTTGCAGCGACATTGTCGTCCTCGCCGCAAGAGATGCTGTTGTGTTT
ACTGGAGGACCG
GCTGTGCCTGTCGCGCTGGGAAGACGAGACGGCCTCGTCTCGTTGGCATCCAACGTCCGAAGAAACATCATCGACACGGGCTTCTCCGTGGACGCCATGGCGGCCAGCTTCACCGCCAAG
GGGCTCACCTTGGACGACCTCGTCACTCTCTCAG
GGGGGCACACCATCGGGTCGGCGCACTGCAACACGTTCCGGGAGCGGTTCCAGCAGGTGGCGAACGGGAGCATGACGCCGGTCGAC
GGGTCGATGAACGCCGACTACGCGAACGAGCTGATCCAGGCGTGCTCGGCGAACGGCACCGTGCCGGCGGGCACGGCCGCCGTGGGCTGCGACTCCGGCTCGGCGTCCGTCTTCGACAAC
ACCTACTTCGCGAACCTGCTGGGCGGGCGGGGCCTGCTGCGCACGGACGCCGCGCTGGTGCAGAACGCGACGACGAGGGCCAAGGTGGCGGAGTTCGCGCAGAGCCAGGACGGCTTCTTC
GCGAGCTGGGCCAGCTCGTACGCCAGGCTCACCAGCCTCGGCGTGAAGGTCGGCGCCGACGGCGAGGTCCGGCGGACCTGCTCCAGCGTCAACGGCTGA

Retrieve as FASTA