Entry information : ZmPrx96 (AC205154.3_FG005)
Entry ID 992
Creation 2007-11-09 (Christophe Dunand)
Last sequence changes 2011-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: ZmPrx96 (AC205154.3_FG005)
Name (synonym) ZmPrx96 (AC205154.3_FG005)
Class Class III peroxidase    [Orthogroup: Prx064]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx96
start..stop
S start..stop
SbPrx79 588 0 1..342 1..348
PviPrx01 537 0 20..342 22..343
SiPrx73 514 0 1..342 1..340
TaPrx99-1B 373 1e-129 17..342 19..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 96695440..96695634 195 N° 2 96694517..96695350 834  
complement(join(96694517..96695350,96695440..96695634))


exon

Literature and cross-references ZmPrx96 (AC205154.3_FG005)
Literature Bohnert,H., Sharp,R.E., Springer,G.K., Poroyko,V., Fredricksen,M., Sharp,L.G., Spollen,W.G., Ries,J., Guillen,A., Khambati,A., Topinka ,C., Davis,G.E., Schachtman,D., Wu,Y. and Nguyen,H.T. NSF Grant DBI-0211842: Functional Genomics of Root Growth and Root Signaling Under Drought.
EST ref. GenBank:   EE679343.1 [3' end]
Protein sequence: ZmPrx96 (AC205154.3_FG005)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (318)
PWM (Da):   %s   36718.41 (34332.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   5.43 (5.43) Peptide Signal:   %s   cut: 25 range:25-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTNLNATVAAVLVMLAFLAGQSVAGRYYYDKVQDKVRKEVEKAMAKNPSVGPALVRLVFHDCWVYGCDGSVLLDSTPTDGTNTEKKAANNIGLAGFEVIDAIKQKVGTDASCADIVAFAARDAADILSGGKIFYTIPGGRKDGVVSSAAVADANLPHPDFNFDELKDNFNASSRGSSFTVEELVVLSGAHSIGVAHLSSYQDRLGPDSTPIDSDYQEALNKATPPGLLKTGQNPTVTNNVRDETDAFQKDAAYNPVAMGVNPKRGVLDNSYYHNNLVNKVLFKSDWVLRTDDFAASKLDEYKNNPAEWNSDFAAAMVKLSSLPAQGNKLEIRKNCRVPNPQY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, intron 1) and 2 ESTs. Missing 'c'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAATCTCAACGCCACCGTCGCTGCTGTGCTCGTGATGCTCGCCTTCCTCGCCGGGCAGTCGGTTGCCGGGCGCTACTACTACGACAAAGTGCAGGACAAGGTGAGAAAGGAAGTG
GAGAAGGCCATGGCGAAAAACCCCAGCGTCGGCCCCGCCCTTGTTCGCTTGGTGTTCCATGACTGCTGGGTCTAT
GTAAGTATGGACATGCATGTTGCCTCTGCTTGAATGCTTGATATA
CAAATACAATCAGGTCTGATCCAAGAATACTGACGGCATTTTAGGGTTGTGATGGCTCCGTGCTCCTAGACAGCACGCCTACTGACGGCACCAACACCGAGAAGAAGGCGGCGAACAACA
TCGGCCTCGCTGGCTTCGAGGTGATCGACGCCATCAAGCAGAAGGTCGGCACTGACGCCTCCTGCGCAGACATCGTCGCCTTCGCGGCGCGCGACGCGGCCGACATCCTCAGCGGCGGCA
AGATCTTCTACACCATCCCCGGCGGCCGCAAGGACGGCGTCGTCTCGTCCGCCGCGGTGGCGGACGCCAACCTCCCGCACCCCGACTTCAACTTCGACGAGCTCAAGGATAACTTCAACG
CGTCCAGCCGAGGCAGCAGCTTCACCGTCGAGGAGCTCGTCGTCCTCTCGGGCGCGCACTCCATCGGCGTCGCTCACCTCTCGTCCTACCAGGACCGCCTGGGGCCCGACTCCACTCCAA
TCGATTCCGACTACCAGGAGGCGCTCAACAAGGCCACACCTCCTGGTTTGCTGAAGACTGGGCAGAACCCGACGGTGACAAACAACGTCCGCGACGAGACTGACGCGTTCCAGAAGGACG
CTGCCTACAACCCCGTGGCCATGGGGGTGAACCCCAAGAGGGGCGTCCTCGACAACAGCTACTACCATAACAACCTCGTCAACAAGGTGCTATTCAAGTCTGACTGGGTACTACGCACGG
ATGACTTCGCCGCCAGCAAGCTCGATGAATACAAGAACAACCCAGCGGAGTGGAATTCCGACTTCGCCGCCGCCATGGTCAAGCTCAGCAGCCTGCCAGCCCAAGGAAACAAGTTGGAGA
TCAGGAAGAACTGCAGGGTACCCAACCCGCAGTACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAATCTCAACGCCACCGTCGCTGCTGTGCTCGTGATGCTCGCCTTCCTCGCCGGGCAGTCGGTTGCCGGGCGCTACTACTACGACAAAGTGCAGGACAAGGTGAGAAAGGAAGTG
GAGAAGGCCATGGCGAAAAACCCCAGCGTCGGCCCCGCCCTTGTTCGCTTGGTGTTCCATGACTGCTGGGTCTAT
GGTTGTGATGGCTCCGTGCTCCTAGACAGCACGCCTACTGACGGC
ACCAACACCGAGAAGAAGGCGGCGAACAACATCGGCCTCGCTGGCTTCGAGGTGATCGACGCCATCAAGCAGAAGGTCGGCACTGACGCCTCCTGCGCAGACATCGTCGCCTTCGCGGCG
CGCGACGCGGCCGACATCCTCAGCGGCGGCAAGATCTTCTACACCATCCCCGGCGGCCGCAAGGACGGCGTCGTCTCGTCCGCCGCGGTGGCGGACGCCAACCTCCCGCACCCCGACTTC
AACTTCGACGAGCTCAAGGATAACTTCAACGCGTCCAGCCGAGGCAGCAGCTTCACCGTCGAGGAGCTCGTCGTCCTCTCGGGCGCGCACTCCATCGGCGTCGCTCACCTCTCGTCCTAC
CAGGACCGCCTGGGGCCCGACTCCACTCCAATCGATTCCGACTACCAGGAGGCGCTCAACAAGGCCACACCTCCTGGTTTGCTGAAGACTGGGCAGAACCCGACGGTGACAAACAACGTC
CGCGACGAGACTGACGCGTTCCAGAAGGACGCTGCCTACAACCCCGTGGCCATGGGGGTGAACCCCAAGAGGGGCGTCCTCGACAACAGCTACTACCATAACAACCTCGTCAACAAGGTG
CTATTCAAGTCTGACTGGGTACTACGCACGGATGACTTCGCCGCCAGCAAGCTCGATGAATACAAGAACAACCCAGCGGAGTGGAATTCCGACTTCGCCGCCGCCATGGTCAAGCTCAGC
AGCCTGCCAGCCCAAGGAAACAAGTTGGAGATCAGGAAGAACTGCAGGGTACCCAACCCGCAGTACTAA

Retrieve as FASTA