Entry information : PcarMnP03
Entry ID 9923
Creation 2011-12-08 (Christophe Dunand)
Last sequence changes 2011-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP03
Name PcarMnP03
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP03
start..stop
S start..stop
PbreMnP07 666 0 1..382 1..380
PbreMnP03 660 0 1..382 1..380
PcMnP03_RP78 659 0 1..382 1..382
PcMnP03_OGC101 657 0 1..382 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3191172..3191303 132 N° 2 3191037..3191115 79 N° 3 3190943..3190982 40 N° 4 3190705..3190882 178
N° 5 3190425..3190646 222 N° 6 3189960..3190374 415 N° 7 3189813..3189895 83  
complement(join(3189813..3189895,3189960..3190374,3190425..3190646,3190705..3190 882,3190943..3190982,3191037..3191115,3191172..3191303))


exon

Literature and cross-references PcarMnP03
DNA ref. JGI genome:   scaffold_5 (3191303..3189813)
Protein sequence: PcarMnP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (363)
PWM (Da):   %s   40170.53 (38320.5)  
PI (pH):   %s   4.11 (4.11) Peptide Signal:   %s   cut: 20 range:20-382
Sequence 423
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFATSLFALVALAAVTTAAPATTQAVCSDGTRVSNEACCAFIPLAQDLQENILMNDCGEDAHEVIRLTFHDAVAISRSQGPSAGGGADGSMLLFPTIEPNFSANNGISDSVNNLIPFMQKHNTISAGDLVQFAGAIALTNCPGAPQLEFLAGRPNHTIPAVDGLIPEPQDNVTHILERFDDAGGFSPFEVIALLASHSIARADKVDETIDAAPFDSTPFVFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPTTVGTDTGEMRLQSDFALARDERTACFWQSFVNEQEFMASSFKSAMAKLAVLGHNRNDLIDCSDVIPTPKPAVNTPASFPATTGPQDLELTCTAEKFPTLTTNAGAQQTLIPHCSDGNMTCNTVQFNGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTACTTCGCTCTTCGCCTTGGTCGCTCTTGCTGCCGTCACCACCGCTGCGCCGGCTACCACTCAGGCAGTCTGCTCTGACGGAACCCGTGTCAGCAACGAGGCCTGCTGC
GCCTTCATCCCC
GTATGTGACATTTCTCGTTATCTCACTCAGTGCGGCGCGCTCAACAATTTATCCAGCTCGCGCAAGATCTGCAGGAGAATATCCTGATGAACGACTGCGGTGAAGATG
CTCACGAGGTCATCCGTCTTACTTTCC
GTAAGCGAAACCACATAGTGCAATAAATCGGGGATTCTAATGATTATTTTACAGACGACGCTGTTGCGATCTCCCGCAGCCAGGGTCCCTCTG
C
GTAGGCAATTTCCGTCTGCACTTGCAAGTACGATTTTCTGACAGATCTTCACGATAATAGCGGTGGTGGAGCTGACGGCTCGATGCTCCTCTTCCCGACCATTGAGCCCAACTTCTCGG
CCAACAACGGTATCAGCGACTCCGTCAACAATCTCATCCCCTTCATGCAGAAGCACAACACCATCAGCGCTGGCGATCTTGTCCAGTTCGCAGGTGCCATCGCGCTCACCAACTGCCCC
G
TAAGTATATTTGCCACTCACTGATGGCGGTACCCGTCTCATACTTTACGATCTATAGGGTGCTCCTCAACTCGAGTTCTTGGCTGGCCGCCCGAACCACACTATTCCCGCCGTCGACGGC
CTGATCCCCGAGCCCCAGGACAACGTCACCCACATTCTCGAGAGGTTCGACGATGCTGGTGGCTTCAGCCCTTTCGAAGTCATCGCCCTGCTCGCTTCCCACTCCATCGCTCGCGCGGAC
AAGGTCGACGAGACGATCGACGCTGCGCCCTTCGACTCC
GTAAGCGACAATGTTTCTTATCATAATCACCCGCTAACCGATATTTGCAGACCCCGTTCGTGTTCGACACCCAGGTCTTCC
TCGAGGTCCTGCTCAAGGGCGTCGGCTTCCCCGGAACCGACAACAACACCGGCGAGGTTGCATCTCCTCTCCCAACGACCGTCGGCACCGACACCGGCGAGATGCGTCTCCAGTCTGACT
TCGCCCTCGCCCGCGACGAGCGCACTGCTTGCTTCTGGCAGAGTTTCGTGAACGAGCAGGAGTTCATGGCGTCGAGCTTCAAGTCGGCGATGGCCAAGCTCGCCGTCCTCGGCCACAACC
GCAACGACCTGATCGACTGCTCCGACGTCATTCCCACGCCCAAGCCCGCCGTGAACACGCCCGCGAGCTTCCCCGCCACCACCGGCCCGCAGGACCTCGAGCTCACGTGCACGGCCGAGA
AGTTCCCGACTCTGACCACAAACG
GTACGTGTCTGCTGATGTTCCTCGCTGTTGGTTGCAACCGTACTGACCATCGTTGCTCGTACAGCTGGTGCGCAGCAGACTCTGATCCCTCACTGC
TCGGACGGCAACATGACGTGCAACACCGTCCAGTTCAACGGCCCCGCTTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCTACTTCGCTCTTCGCCTTGGTCGCTCTTGCTGCCGTCACCACCGCTGCGCCGGCTACCACTCAGGCAGTCTGCTCTGACGGAACCCGTGTCAGCAACGAGGCCTGCTGC
GCCTTCATCCCC
CTCGCGCAAGATCTGCAGGAGAATATCCTGATGAACGACTGCGGTGAAGATGCTCACGAGGTCATCCGTCTTACTTTCCACGACGCTGTTGCGATCTCCCGCAGCCAG
GGTCCCTCTGC
CGGTGGTGGAGCTGACGGCTCGATGCTCCTCTTCCCGACCATTGAGCCCAACTTCTCGGCCAACAACGGTATCAGCGACTCCGTCAACAATCTCATCCCCTTCATGCAG
AAGCACAACACCATCAGCGCTGGCGATCTTGTCCAGTTCGCAGGTGCCATCGCGCTCACCAACTGCCCC
GGTGCTCCTCAACTCGAGTTCTTGGCTGGCCGCCCGAACCACACTATTCCC
GCCGTCGACGGCCTGATCCCCGAGCCCCAGGACAACGTCACCCACATTCTCGAGAGGTTCGACGATGCTGGTGGCTTCAGCCCTTTCGAAGTCATCGCCCTGCTCGCTTCCCACTCCATC
GCTCGCGCGGACAAGGTCGACGAGACGATCGACGCTGCGCCCTTCGACTCC
ACCCCGTTCGTGTTCGACACCCAGGTCTTCCTCGAGGTCCTGCTCAAGGGCGTCGGCTTCCCCGGAACC
GACAACAACACCGGCGAGGTTGCATCTCCTCTCCCAACGACCGTCGGCACCGACACCGGCGAGATGCGTCTCCAGTCTGACTTCGCCCTCGCCCGCGACGAGCGCACTGCTTGCTTCTGG
CAGAGTTTCGTGAACGAGCAGGAGTTCATGGCGTCGAGCTTCAAGTCGGCGATGGCCAAGCTCGCCGTCCTCGGCCACAACCGCAACGACCTGATCGACTGCTCCGACGTCATTCCCACG
CCCAAGCCCGCCGTGAACACGCCCGCGAGCTTCCCCGCCACCACCGGCCCGCAGGACCTCGAGCTCACGTGCACGGCCGAGAAGTTCCCGACTCTGACCACAAACG
CTGGTGCGCAGCAG
ACTCTGATCCCTCACTGCTCGGACGGCAACATGACGTGCAACACCGTCCAGTTCAACGGCCCCGCTTA

Retrieve as FASTA