Entry information : PcarMnP02
Entry ID 9924
Creation 2011-12-08 (Christophe Dunand)
Last sequence changes 2011-12-08 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP02
Name PcarMnP02
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP02
start..stop
S start..stop
PsoMnP03 661 0 1..378 1..382
CsuMnP10 651 0 1..378 1..378
CsuMnP05 647 0 1..378 1..377
PsoMnP02 645 0 1..378 1..377
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 495315..495434 120 N° 2 495495..495546 52 N° 3 495603..495669 67 N° 4 495722..495899 178
N° 5 495962..496183 222 N° 6 496238..496652 415 N° 7 496711..496793 83  
join(495315..495434,495495..495546,495603..495669,495722..495899,495962..496183, 496238..496652,496711..496793)


exon

Literature and cross-references PcarMnP02
DNA ref. JGI genome:   scaffold_10 (495315..496793)
Cluster/Prediction ref. JGI gene:   262882
Protein sequence: PcarMnP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39909.68 (38095.6)  
PI (pH):   %s   4.44 (4.39) Peptide Signal:   %s   cut: 19 range:19-378
Sequence 419
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSSLLALVALVAVTRAAPTAVCSDGTRVSNSACCAFIPLAQDLQETLFMNECGEDAHEAIRLTFHDAVAISRSKGAKAGGGADGSMLLFPTVEPNFSANNGISDSVNNLIPLMQKHDTISAGDLVQFAGAVALSNCPGAPRLEFLAGRPNKTIAAIDGLIPEPQDDVTKILERFDDAGGFTPFEVVSLLASHSVARADKVDSTIDAAPFDSTPFVFDTQVFLEVLLKGVGFPGTNNNTGEVASPLPNTTGTDTGEMRLQSDFALAHDERTACFWQGFVNQQDFMSNSFQQAMAKLAILGHDRNKLVDCSDVVPVPQPAVKKPATFPATTGPKDLQLTCRAERFPTLTTDNAAQETLIPHCPDGSMNCTTVQFNGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTCTCCTCTCTTCTGGCCCTCGTTGCCCTCGTCGCGGTCACTCGCGCAGCCCCGACCGCAGTCTGCTCTGACGGCACTCGCGTCAGCAACTCTGCTTGCTGTGCTTTCATTCCTG
TGTGTCATTACTGCATTCTGGCTTCTTATATCTTTGTTCACAGCTTCTATCCTTCATAGCTTGCTCAGGATCTGCAGGAGACCCTTTTCATGAATGAGTGTGGTGAAGATGGTTAGTCTA
TTTCAAACAGCCTTCATTCCGCCCTACCTAATCATGGCTACTTGCAGCTCACGAGGCCATTCGTCTGACTTTCCACGATGCTGTCGCGATCTCCCGCTCCAAGGGAGCCAAGGCGTAAGT
CCTTACTTGGCCTGGCTTTTACCTGTCTGACGTAACGGTCCCACAGCGGAGGAGGCGCCGACGGCTCGATGCTCCTGTTCCCCACCGTCGAGCCTAACTTCTCGGCCAACAACGGTATCA
GCGACTCTGTCAACAACCTCATTCCTCTCATGCAGAAGCACGACACCATCAGCGCTGGTGACCTCGTCCAGTTCGCTGGTGCCGTTGCCCTTAGTAACTGCCCC
GTAAGCCTTACCTACG
ACATATTCTCCGCCCGCTTGCTCATATTGACATTGAATTTCTGCAGGGCGCGCCGCGTCTCGAATTCTTGGCTGGTCGCCCGAACAAGACCATTGCTGCCATCGATGGCCTGATCCCTGA
GCCTCAGGACGATGTCACCAAGATCCTCGAGCGTTTCGATGATGCTGGAGGCTTCACGCCCTTCGAGGTCGTATCTCTCCTTGCGTCCCACTCTGTCGCCCGCGCGGATAAGGTCGACTC
GACCATTGATGCCGCTCCCTTCGACTCA
GTCAGTGGCTCGTCCAAGTGCTTATGTTTCCACACCTGACCAGCTCTCCTCTAGACGCCGTTTGTCTTTGACACACAGGTCTTCCTCGAGGT
TCTGCTCAAAGGCGTAGGTTTCCCAGGAACGAACAACAACACGGGCGAGGTCGCCTCGCCTCTCCCGAACACCACCGGTACCGACACCGGCGAGATGCGTCTGCAGTCCGACTTTGCGCT
CGCACACGACGAGCGCACGGCGTGCTTCTGGCAGGGCTTCGTCAACCAGCAGGACTTCATGTCGAACAGCTTCCAGCAAGCGATGGCGAAGCTCGCCATCCTTGGCCACGATCGCAACAA
GCTGGTCGACTGCAGCGACGTCGTCCCCGTGCCGCAACCCGCCGTCAAGAAGCCCGCGACGTTCCCCGCGACGACCGGCCCGAAGGATCTTCAGCTCACGTGCCGCGCCGAGAGGTTCCC
GACCCTCACCACCGACA
GTGCGTGTCTCTTCTTTCATTCGAGGTGCCGAGTGCTGATTGTGTGTTCTTGCTGCAGATGCTGCTCAAGAGACTCTGATTCCTCACTGCCCCGACGGCAGCA
TGAACTGCACTACGGTCCAGTTCAATGGCCCGGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTCTCCTCTCTTCTGGCCCTCGTTGCCCTCGTCGCGGTCACTCGCGCAGCCCCGACCGCAGTCTGCTCTGACGGCACTCGCGTCAGCAACTCTGCTTGCTGTGCTTTCATTCCTC
TTGCTCAGGATCTGCAGGAGACCCTTTTCATGAATGAGTGTGGTGAAGATG
CTCACGAGGCCATTCGTCTGACTTTCCACGATGCTGTCGCGATCTCCCGCTCCAAGGGAGCCAAGGCCG
GAGGAGGCGCCGACGGCTCGATGCTCCTGTTCCCCACCGTCGAGCCTAACTTCTCGGCCAACAACGGTATCAGCGACTCTGTCAACAACCTCATTCCTCTCATGCAGAAGCACGACACCA
TCAGCGCTGGTGACCTCGTCCAGTTCGCTGGTGCCGTTGCCCTTAGTAACTGCCCC
GGCGCGCCGCGTCTCGAATTCTTGGCTGGTCGCCCGAACAAGACCATTGCTGCCATCGATGGCC
TGATCCCTGAGCCTCAGGACGATGTCACCAAGATCCTCGAGCGTTTCGATGATGCTGGAGGCTTCACGCCCTTCGAGGTCGTATCTCTCCTTGCGTCCCACTCTGTCGCCCGCGCGGATA
AGGTCGACTCGACCATTGATGCCGCTCCCTTCGACTCA
ACGCCGTTTGTCTTTGACACACAGGTCTTCCTCGAGGTTCTGCTCAAAGGCGTAGGTTTCCCAGGAACGAACAACAACACGG
GCGAGGTCGCCTCGCCTCTCCCGAACACCACCGGTACCGACACCGGCGAGATGCGTCTGCAGTCCGACTTTGCGCTCGCACACGACGAGCGCACGGCGTGCTTCTGGCAGGGCTTCGTCA
ACCAGCAGGACTTCATGTCGAACAGCTTCCAGCAAGCGATGGCGAAGCTCGCCATCCTTGGCCACGATCGCAACAAGCTGGTCGACTGCAGCGACGTCGTCCCCGTGCCGCAACCCGCCG
TCAAGAAGCCCGCGACGTTCCCCGCGACGACCGGCCCGAAGGATCTTCAGCTCACGTGCCGCGCCGAGAGGTTCCCGACCCTCACCACCGACA
ATGCTGCTCAAGAGACTCTGATTCCTC
ACTGCCCCGACGGCAGCATGAACTGCACTACGGTCCAGTTCAATGGCCCGGCATAA

Retrieve as FASTA