Entry information : PcarMnP07
Entry ID 9925
Creation 2011-12-02 (Christophe Dunand)
Last sequence changes 2012-03-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: PcarMnP07
Name PcarMnP07
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarMnP07
start..stop
S start..stop
PcarMnP01 702 0 1..385 1..385
PcarMnP06 676 0 1..383 1..383
PcarMnP05 641 0 1..385 1..385
PbreMnP05 623 0 26..385 23..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3196046..3196180 135 N° 2 3196238..3196289 52 N° 3 3196344..3196370 27 N° 4 3196426..3196465 40
N° 5 3196523..3196700 178 N° 6 3196764..3196985 222 N° 7 3197048..3197462 415 N° 8 3197525..3197613 89
join(3196046..3196180,3196238..3196289,3196344..3196370,3196426..3196465,3196523 ..3196700,3196764..3196985,3197048..3197462,3197525..3197613)


exon

Literature and cross-references PcarMnP07
DNA ref. JGI genome:   scaffold_5 (3196046..3197613)
Cluster/Prediction ref. JGI gene:   256997
Protein sequence: PcarMnP07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   385 (365)
PWM (Da):   %s   39887.56 (37806.4)  
PI (pH):   %s   4.03 (3.94) Peptide Signal:   %s   cut: 21 range:21-385
Sequence 426
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKFSSLFALVAVAATVRAAPASTTATCSDGTQVPDEVCCNFVPLVSALQNTLFMGDCGEDAHEVIRLTFHDAIAISQSQGPAAGGGADGSMLIFPTVEPSFAANAGIGDSVNNLIPFLSQFPNVTAGDLIQFAGTVALSNCPGAPQLEFLAGRPNATAPAVDGLIPEPQDNVTSILDRFADAGGFSPFEVISLLASHSIARADKVDPTIDAAPFDSTPFVFDTQVFLEVLLKGVGFPGTPNNTGEVASPLPLTVGSDTGELRLQSDFALARDSRTACFWQGFVNQQEFMASSFQAAMSKMTILGHNRADLIDCSAVVPVPKPAVNKPASFPATTGPQDLELSCTTSQFPTLTVDAGSQETVIPHCSDGNMTCNTVQFTGPAID

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAATTCTCTTCGCTTTTCGCCCTCGTCGCCGTTGCTGCGACCGTGCGCGCCGCTCCGGCCTCCACCACCGCCACCTGCTCCGATGGCACACAAGTCCCCGACGAAGTGTGCT
GCAACTTCGTTCCT
GTATGTTTACTTCACACTTTTCCACGGTGTTATAGCGACTGAAACACTGTAATGCAGCTTGTGTCAGCTCTCCAGAACACGCTGTTCATGGGAGACTGCGGTGAAG
ACG
GTAGGCCACTCATCTTCCCTGGTTTATAGCGATAACACTAACGTTTCATCCAAGCCCACGAGGTCATCCGTCTTACTTTCCGTGAGTGACACTCTGTCAGACGTAGCTGGCAGCAAT
CTTACCATTATCTTGCCAGACGATGCCATCGCTATCTCTCAGAGCCAAGGTCCCGCGGCGTGAGTGGCACCAAATCTTGACGAGTGGTCGGAAGTATACTGACCGCGAATACGCAGTGGT
GGAGGAGCTGACGGGTCAATGCTCATCTTCCCGACCGTCGAGCCATCGTTCGCAGCGAACGCGGGCATCGGCGACAGTGTCAACAACCTGATTCCGTTCCTGTCCCAGTTCCCCAATGTC
ACCGCCGGCGACTTGATCCAATTCGCAGGCACGGTCGCACTGAGCAACTGCCCG
GTAAGCGGTCGTGTGCTGCTTAGCATCTGTTGCGCTCCGCACTGACATGGTCTCTCACAACAGGGT
GCGCCGCAACTGGAGTTCCTTGCCGGTCGCCCGAATGCGACTGCGCCGGCCGTTGACGGCCTGATCCCCGAGCCACAGGACAACGTCACGTCGATCCTCGACCGATTTGCCGATGCTGGT
GGCTTCAGCCCCTTCGAGGTCATCTCCCTCCTTGCCTCTCACTCCATTGCTCGTGCCGACAAGGTTGACCCGACGATCGACGCTGCGCCATTCGACTCC
GTAAGTAGCCATGCTGTCTCT
CTTGGGAGTCGAACTCCGCTGACAATAATTCACCCGTGCAGACTCCGTTCGTGTTCGACACTCAGGTCTTCCTCGAGGTTCTGCTCAAGGGTGTCGGCTTCCCTGGCACCCCCAACAACA
CCGGCGAGGTCGCCTCCCCCCTCCCTCTCACCGTCGGCAGCGACACCGGCGAGCTGCGTCTGCAATCGGACTTTGCGCTGGCGCGCGACTCACGCACGGCGTGCTTCTGGCAGGGCTTCG
TCAACCAGCAGGAGTTCATGGCATCGAGCTTCCAGGCGGCCATGTCCAAGATGACGATCCTCGGCCACAACCGCGCCGATCTGATCGACTGCTCGGCCGTCGTCCCCGTTCCGAAGCCTG
CGGTCAACAAGCCTGCGAGCTTCCCGGCGACGACGGGCCCTCAGGACCTGGAGCTGTCGTGCACGACCTCGCAGTTCCCGACGCTCACCGTTGATG
GTACGTGTCCCAGTTGTGTACGCA
TGGAGTATGATAGAGGCTGACTCTCGACTCTGGTACAGCCGGCTCACAGGAGACGGTGATTCCGCACTGCTCGGACGGCAACATGACGTGCAACACTGTCCAGTTCACCGGCCCGGCTAT
CGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTTCAAATTCTCTTCGCTTTTCGCCCTCGTCGCCGTTGCTGCGACCGTGCGCGCCGCTCCGGCCTCCACCACCGCCACCTGCTCCGATGGCACACAAGTCCCCGACGAAGTGTGCT
GCAACTTCGTTCCT
CTTGTGTCAGCTCTCCAGAACACGCTGTTCATGGGAGACTGCGGTGAAGACGCCCACGAGGTCATCCGTCTTACTTTCCACGATGCCATCGCTATCTCTCAGAGCC
AAGGTCCCGCGGC
TGGTGGAGGAGCTGACGGGTCAATGCTCATCTTCCCGACCGTCGAGCCATCGTTCGCAGCGAACGCGGGCATCGGCGACAGTGTCAACAACCTGATTCCGTTCCTGT
CCCAGTTCCCCAATGTCACCGCCGGCGACTTGATCCAATTCGCAGGCACGGTCGCACTGAGCAACTGCCCG
GGTGCGCCGCAACTGGAGTTCCTTGCCGGTCGCCCGAATGCGACTGCGC
CGGCCGTTGACGGCCTGATCCCCGAGCCACAGGACAACGTCACGTCGATCCTCGACCGATTTGCCGATGCTGGTGGCTTCAGCCCCTTCGAGGTCATCTCCCTCCTTGCCTCTCACTCCA
TTGCTCGTGCCGACAAGGTTGACCCGACGATCGACGCTGCGCCATTCGACTCC
ACTCCGTTCGTGTTCGACACTCAGGTCTTCCTCGAGGTTCTGCTCAAGGGTGTCGGCTTCCCTGGCA
CCCCCAACAACACCGGCGAGGTCGCCTCCCCCCTCCCTCTCACCGTCGGCAGCGACACCGGCGAGCTGCGTCTGCAATCGGACTTTGCGCTGGCGCGCGACTCACGCACGGCGTGCTTCT
GGCAGGGCTTCGTCAACCAGCAGGAGTTCATGGCATCGAGCTTCCAGGCGGCCATGTCCAAGATGACGATCCTCGGCCACAACCGCGCCGATCTGATCGACTGCTCGGCCGTCGTCCCCG
TTCCGAAGCCTGCGGTCAACAAGCCTGCGAGCTTCCCGGCGACGACGGGCCCTCAGGACCTGGAGCTGTCGTGCACGACCTCGCAGTTCCCGACGCTCACCGTTGATG
CCGGCTCACAGG
AGACGGTGATTCCGCACTGCTCGGACGGCAACATGACGTGCAACACTGTCCAGTTCACCGGCCCGGCTATCGACTAA

Retrieve as FASTA