Entry information : PcarLiP01 (PcarLiPA)
Entry ID 9932
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-09 (Christophe Dunand)
Peroxidase information: PcarLiP01 (PcarLiPA)
Name (synonym) PcarLiP01 (PcarLiPA)
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarLiP01
start..stop
S start..stop
PcLiP07_RF78 659 0 1..372 1..372
PcLiP02_RP78 656 0 1..372 1..372
PsoLiP07 654 0 1..372 1..373
PcLiP09_RP78 651 0 1..372 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1971646..1971706 61 N° 2 1971429..1971582 154 N° 3 1971317..1971373 57 N° 4 1971048..1971262 215
N° 5 1970949..1970990 42 N° 6 1970818..1970896 79 N° 7 1970524..1970765 242 N° 8 1970283..1970464 182
N° 9 1970160..1970224 65 N° 10 1970083..1970104 22  
complement(join(1970083..1970104,1970160..1970224,1970283..1970464,1970524..1970 765,1970818..1970896,1970949..1970990,1971048..1971262,1971317..1971373,1971429. .1971582,1971646..1971706))


exon

Literature and cross-references PcarLiP01 (PcarLiPA)
DNA ref. JGI genome:   scaffold_10 (1971706..1970083)
Cluster/Prediction ref. JGI gene:   263501
Protein sequence: PcarLiP01 (PcarLiPA)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   372 (351)
PWM (Da):   %s   39120.21 (36893.9)  
PI (pH):   %s   4.18 (4.14) Peptide Signal:   %s   cut: 22 range:22-372
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKQLIVAISIALSLQVTQAVVLKDKRATCSNGASVGDESCCAWFDVLDDIQQNLFNGGQCGAEAHESIRLVFHDSIAISPAMEAQGKFGGGGADGSIILFDEIETAFHPNIGLDEVVNLQKPFIAKHGVTPGDFIAFAGAVAMSNCPGAPQMNFFTGRAATQAAPDGLVPEPFHTVDQIIDRVNDAGQFDELELVWMLSAHSVAASNDVDPTVQGLPFDSTPGVFDSQFFVETQLRGVLFPGSGGNQGEVESGLAGEIRLQSDHTLARDSRTACEWQSFNNQSKLTSDFQFIFLALTQLGQNPDAMTDCSAVIPISKPIPGNGPFSFFPAGKTSADVEQCASTPFPSLTTLPGPTTSVARIPPPPGA

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCATCGTCGCAATTTCCATCGCGCTCTCTCTCCAGGTCACTCAAGGTACGTTTCTGTGTCCCCGAGCATATTCACGCTTGTGCCAATGATACCGAACACCGTGT
GCAGCTGTCGTGCTGAAGGACAAGCGCGCCACCTGCTCAAACGGTGCCAGCGTCGGCGACGAATCGTGCTGCGCATGGTTCGACGTCCTCGACGACATCCAGCAGAACCTCTTCAACGGA
GGCCAATGCGGCGCTGAAGCCCACGAGTCCATCCGACT
GTGAGTGCTTCTGCGGACCAAGCGTTCTGCACATGAGACTAATTTAAATCTGCAGCGTCTTCCACGACTCCATCGCCATCTC
TCCTGCAATGGAGGCACAGGGGAAGTTTGG
GTATGTTCCCTGTGCATTGCATGTCTCTCAAAAGTGTCACTGAGAAATTTATAGTGGTGGAGGTGCCGACGGCTCCATCATTCTCTTCGA
TGAGATTGAGACCGCATTCCACCCGAACATCGGTCTCGACGAAGTCGTCAATCTTCAGAAGCCATTCATCGCTAAACACGGTGTCACCCCCGGCGATTTTATTGCCTTCGCCGGTGCAGT
CGCCATGAGCAACTGCCCCGGTGCCCCGCAGATGAACTTCTTCACTGGTCGCGCTCCTG
GTACGCCGACGTTTTTCAATCGGCAAATAATTTTGATTATTTATCTGCGTTCTGCAGCTAC
CCAAGCCGCGCCCGATGGTCTCGTTCCCGAGCCGTTCC
GTACGTCACCAAAGCATTGAAAAGATTCGGAATGAAGCTGATCAACACACAGACACTGTCGACCAGATCATTGACCGTGTCA
ACGATGCCGGCCAGTTCGATGAGCTCGAGCTTGTCTGGATGCTCTCGGC
GTGAGTGCTTTGCGCGTTTTCCACCACTCCCGCTCTGACCATGCGATCTCAGCCACTCTGTCGCGGCCTCC
AACGACGTCGACCCGACTGTCCAAGGCCTGCCGTTCGACTCCACTCCCGGCGTCTTTGACTCCCAGTTCTTCGTCGAGACCCAGCTACGCGGTGTGCTCTTCCCCGGCTCTGGGGGCAAC
CAAGGCGAGGTCGAGTCTGGACTCGCGGGTGAAATCCGTCTTCAGTCCGACCATACCCTCGCGCGCGACTCGCGCACGGCCTGCGAGTGGCAGTCCTTTGTCA
GTATGTATCGCCCCGAA
CTAGATATAGGTGCTACAGAAAATACTGACAACGGGCCACAGACAACCAGTCGAAGCTGACGAGCGACTTCCAGTTCATCTTCCTCGCGCTCACACAGCTCGGCCAGAACCCGGACGCGA
TGACCGACTGCTCGGCCGTCATTCCGATCTCCAAGCCCATCCCCGGCAACGGCCCGTTCTCGTTCTTCCCCGCCGGCAAGACCAGCGCCGACGTCGAGCAGGCT
GTGCGTCCTCCGATTT
GCCACGCACGAGCGTGACGGAAGCTGACTGCCCCTCTTCTAGTGCGCGTCCACCCCCTTCCCGAGCCTCACGACTCTCCCTGGCCCCACGACTTCGGTCGCTCGCATGTACGTAGACATT
TGGAACGGATTGAGTGTTCTTGCTGACATGTTCCCTCTCTAGCCCCCCGCCTCCCGGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGCAGCTCATCGTCGCAATTTCCATCGCGCTCTCTCTCCAGGTCACTCAAGCTGTCGTGCTGAAGGACAAGCGCGCCACCTGCTCAAACGGTGCCAGCGTCGGCGACGAA
TCGTGCTGCGCATGGTTCGACGTCCTCGACGACATCCAGCAGAACCTCTTCAACGGAGGCCAATGCGGCGCTGAAGCCCACGAGTCCATCCGACT
CGTCTTCCACGACTCCATCGCCATC
TCTCCTGCAATGGAGGCACAGGGGAAGTTTGG
TGGTGGAGGTGCCGACGGCTCCATCATTCTCTTCGATGAGATTGAGACCGCATTCCACCCGAACATCGGTCTCGACGAAGTCGTCAAT
CTTCAGAAGCCATTCATCGCTAAACACGGTGTCACCCCCGGCGATTTTATTGCCTTCGCCGGTGCAGTCGCCATGAGCAACTGCCCCGGTGCCCCGCAGATGAACTTCTTCACTGGTCGC
GCTCCTG
CTACCCAAGCCGCGCCCGATGGTCTCGTTCCCGAGCCGTTCCACACTGTCGACCAGATCATTGACCGTGTCAACGATGCCGGCCAGTTCGATGAGCTCGAGCTTGTCTGGATG
CTCTCGGC
CCACTCTGTCGCGGCCTCCAACGACGTCGACCCGACTGTCCAAGGCCTGCCGTTCGACTCCACTCCCGGCGTCTTTGACTCCCAGTTCTTCGTCGAGACCCAGCTACGCGGT
GTGCTCTTCCCCGGCTCTGGGGGCAACCAAGGCGAGGTCGAGTCTGGACTCGCGGGTGAAATCCGTCTTCAGTCCGACCATACCCTCGCGCGCGACTCGCGCACGGCCTGCGAGTGGCAG
TCCTTTGTCA
ACAACCAGTCGAAGCTGACGAGCGACTTCCAGTTCATCTTCCTCGCGCTCACACAGCTCGGCCAGAACCCGGACGCGATGACCGACTGCTCGGCCGTCATTCCGATCTCC
AAGCCCATCCCCGGCAACGGCCCGTTCTCGTTCTTCCCCGCCGGCAAGACCAGCGCCGACGTCGAGCAGGCT
TGCGCGTCCACCCCCTTCCCGAGCCTCACGACTCTCCCTGGCCCCACG
ACTTCGGTCGCTCGCAT
CCCCCCGCCTCCCGGTGCTTAA

Retrieve as FASTA