Entry information : ZmPrx100(Zm00001d004459 / GRMZM2G067096)
Entry ID 996
Creation 2005-12-12 (Christophe Dunand)
Last sequence changes 2011-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2023-01-02 (Christophe Dunand)
Peroxidase information: ZmPrx100(Zm00001d004459 / GRMZM2G067096)
Name ZmPrx100(Zm00001d004459 / GRMZM2G067096)
Class Class III peroxidase    [Orthogroup: Prx022]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx100
start..stop
S start..stop
SiPrx22 585 0 5..381 3..367
SbPrx78 560 0 1..378 1..387
TaPrx169-1B 506 0 3..378 1..367
BdiPrx93 504 2.71e-180 7..377 5..358
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '996' 'complement(join(110087792..110088219,110088313..110088673,110088744..110089100))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 110088744..110089100 355 N° 2 110088313..110088673 359 N° 3 110087792..110088219 426  
complement(join(110087792..110088219,110088313..110088673,110088744..110089100))


exon

Literature and cross-references ZmPrx100(Zm00001d004459 / GRMZM2G067096)
Literature Hunter,B.G. et al., unpublished
Protein ref. UniProtKB:   B4G1C4  B4FWA3 [5' end]  B4FUP9 [3' end]  B4FUI8 [Incorrect splicing]
mRNA ref. GenBank:   BT043162
Protein sequence: ZmPrx100(Zm00001d004459 / GRMZM2G067096)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (354)
PWM (Da):   %s   40086.61 (37451.1)  
PI (pH):   %s   4.75 (4.68) Peptide Signal:   %s   cut: 28 range:28-381
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLGPPARGAICLLVVSSSIVVLSTAGGLGSDATSRSAAAYLSV
DDDYGEEDESGDSSFSFPDPETSSASTGLVFGFYDDKCPDAEEMVSSMVRKLYHADPNVAAALVRLFFHDCFIH
GCDASVLLDRVGGQRSERDAGPNQSLRGLGAVEAIKRGVEKACPGTVSCADILALAARDSLVLVGGPTYPVLTGRRDSAQSFYYDADGGGIPPPNATYAMTLDAFARRGQFTERETVALLGAHSIGKVRCRFIADRIYNFAGTGAPDDSIDPDMVGEMRAACGGGDGAAPMEMGYYRQGREVGFGAHYYAELLEGRGILRADQQLTAGSTVRWVRVYASGARGEELFRDDFAHAMVKLSA
LAPLTGSAGQVRITCSNPVRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 3) and 59 ESTs. Also found in AC193458.3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTATTAGGACCTCCGGCACGGGGAGCCATCTGCTTGCTAGTTGTGTCGTCGTCGATCGTGGTCCTCAGCACGGCCGGTGGTCTCGGATCCGATGCCACTAGTAGGTCCGCCGCT
GCCTATCTCTCAGTTGACGACGACTACGGGGAGGAGGACGAGAGCGGCGACTCCTCCTTCTCCTTCCCCGACCCCGAGACGAGTTCAGCTTCAACCGGGCTAGTGTTCGGGTTCTACGAC
GACAAGTGCCCGGACGCCGAGGAGATGGTGTCGTCCATGGTGCGGAAGCTCTACCACGCGGACCCCAACGTCGCAGCCGCACTCGTCCGCCTCTTCTTCCACGACTGCTTCATCCAC
GTA
CGTACGTCGGTTCTTGCTGCTGCATGTCTTGTGTCTGTGAACTCCATGTCGACGATCGAGCGTGCAGGGGGCTGCGACGCCTCGGTGCTGCTGGACCGCGTCGGCGGCCAGAGATCGGAG
CGCGACGCCGGCCCGAACCAGTCGCTTCGCGGCCTGGGCGCCGTCGAGGCCATCAAACGGGGAGTGGAGAAGGCGTGCCCCGGGACCGTCTCCTGCGCGGACATCCTGGCGCTGGCCGCG
CGGGACAGCCTCGTGCTGGTGGGCGGGCCTACCTACCCAGTGCTCACGGGCCGCCGCGACAGCGCCCAGAGCTTCTACTACGACGCGGACGGAGGTGGCATCCCGCCGCCGAACGCCACC
TACGCCATGACGCTCGACGCGTTCGCGCGCCGCGGGCAGTTCACGGAGCGTGAGACCGTCGCGCTCCTAG
GTTCGCCGTCGCCTGACGATCTGACTCTCTGAGTCTGAGCTGCGCAACTC
CCTGCATGCAGTGACGCAAAAGGCAGTCTTGCTCTGCGCGCAGGAGAGCCCACAGCATCGGGAAGGTGCGGTGCAGGTTCATCGCGGACAGGATCTACAACTTCGCCGGGACCGGCGCGC
CGGACGACTCCATCGACCCGGACATGGTCGGCGAGATGCGCGCGGCGTGCGGCGGCGGCGACGGCGCGGCGCCGATGGAGATGGGGTACTACAGGCAGGGCCGGGAGGTGGGCTTCGGCG
CGCACTACTACGCCGAGCTGTTGGAGGGCCGGGGCATCCTGCGCGCCGACCAGCAGCTCACGGCGGGGAGCACCGTGCGGTGGGTGCGCGTGTACGCGTCCGGAGCGCGCGGCGAGGAGC
TGTTCCGCGACGACTTCGCGCACGCCATGGTGAAGCTGTCGGCGCTCGCGCCGCTCACGGGGTCGGCTGGCCAGGTCCGGATCACCTGCTCCAACCCCGTCCGTCCCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTTATTAGGACCTCCGGCACGGGGAGCCATCTGCTTGCTAGTTGTGTCGTCGTCGATCGTGGTCCTCAGCACGGCCGGTGGTCTCGGATCCGATGCCACTAGTAGGTCCGCCGCT
GCCTATCTCTCAGTTGACGACGACTACGGGGAGGAGGACGAGAGCGGCGACTCCTCCTTCTCCTTCCCCGACCCCGAGACGAGTTCAGCTTCAACCGGGCTAGTGTTCGGGTTCTACGAC
GACAAGTGCCCGGACGCCGAGGAGATGGTGTCGTCCATGGTGCGGAAGCTCTACCACGCGGACCCCAACGTCGCAGCCGCACTCGTCCGCCTCTTCTTCCACGACTGCTTCATCCAC
GGC
TGCGACGCCTCGGTGCTGCTGGACCGCGTCGGCGGCCAGAGATCGGAGCGCGACGCCGGCCCGAACCAGTCGCTTCGCGGCCTGGGCGCCGTCGAGGCCATCAAACGGGGAGTGGAGAAG
GCGTGCCCCGGGACCGTCTCCTGCGCGGACATCCTGGCGCTGGCCGCGCGGGACAGCCTCGTGCTGGTGGGCGGGCCTACCTACCCAGTGCTCACGGGCCGCCGCGACAGCGCCCAGAGC
TTCTACTACGACGCGGACGGAGGTGGCATCCCGCCGCCGAACGCCACCTACGCCATGACGCTCGACGCGTTCGCGCGCCGCGGGCAGTTCACGGAGCGTGAGACCGTCGCGCTCCTAG
GA
GCCCACAGCATCGGGAAGGTGCGGTGCAGGTTCATCGCGGACAGGATCTACAACTTCGCCGGGACCGGCGCGCCGGACGACTCCATCGACCCGGACATGGTCGGCGAGATGCGCGCGGCG
TGCGGCGGCGGCGACGGCGCGGCGCCGATGGAGATGGGGTACTACAGGCAGGGCCGGGAGGTGGGCTTCGGCGCGCACTACTACGCCGAGCTGTTGGAGGGCCGGGGCATCCTGCGCGCC
GACCAGCAGCTCACGGCGGGGAGCACCGTGCGGTGGGTGCGCGTGTACGCGTCCGGAGCGCGCGGCGAGGAGCTGTTCCGCGACGACTTCGCGCACGCCATGGTGAAGCTGTCGGCGCTC
GCGCCGCTCACGGGGTCGGCTGGCCAGGTCCGGATCACCTGCTCCAACCCCGTCCGTCCCAACTGA

Retrieve as FASTA