Entry information : PcarKat01
Entry ID 9960
Creation 2011-12-14 (Christophe Dunand)
Last sequence changes 2012-04-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-11 (Christophe Dunand)
Peroxidase information: PcarKat01
Name PcarKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarKat01
start..stop
S start..stop
PcKat01 878 0 1..510 1..510
PplKat01 800 0 1..506 1..506
LbiKat01 776 0 1..508 1..518
SbreKat01 749 0 1..511 1..521
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1328693..1328816 124 N° 2 1328581..1328639 59 N° 3 1328353..1328524 172 N° 4 1327852..1328303 452
N° 5 1327328..1327796 469 N° 6 1327144..1327269 126 N° 7 1326954..1327087 134  
complement(join(1326954..1327087,1327144..1327269,1327328..1327796,1327852..1328 303,1328353..1328524,1328581..1328639,1328693..1328816))


exon

Literature and cross-references PcarKat01
DNA ref. JGI genome:   scaffold_7 (1328816..1326954)
EST ref. GenBank:   HS494617.1 [3' end]   HS499494.1 [Fragment]
Cluster/Prediction ref. JGI gene:   259598
Protein sequence: PcarKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   511
PWM (Da):   %s   57470.01  
PI (pH):   %s   7.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPTKRALEAQDKAVYTTSSGAPVAEPYAAQRVGNNGPLLLQDFSLIDSLAHFDRERIPERVHAKGAGCHGFFEVTHDITDLSCAALFSEVGKKTPVTMRFSTVGGELGSADSARDPRGFAIKLKTEHGNLDWVFNNTPIFFIRDPAKFPHFIHTQKRDPETHLKDADPFWDYFSLNPESIHQVMILFSDRGTPYGFHHMHGYSGHTYKFVNAEGKFVYVQIHVRKEGGFKTIDNATAGKLAGENPDYGIELLHNDVAAGKFPEWKLFQTMTPEQAEKFRYNICDLTKVWPHAEFPLRPFGKIVLNKNPENYFAEVEQVAFSPSHTVPGFEPSNDPVLQSRLFSYPDTHRHRLGTNYQQLPVNRPLVPIANFQRDGPMAFENQGTRPNYQSSLVPLTYKPKPYEQVKHETWLAAAKTDLSFITELDFEQPRALWQKVFDNTQKEHFVSNVAGHFGNVKSPEVKARQLSVFAAVDQDLSDRIAKAIGHPSVKPLSVAPAAQAIRFQYNQSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 5 ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCAAGCGCGCTCTGGAAGCTCAAGACAAAGCGGTCTACACGACCTCCAGCGGTGCCCCCGTTGCCGAACCCTACGCCGCTCAGCGCGTTGGCAACAACGGACCCCTCCTCCTT
CAAG
GTGAGTCTCCATACCTTCCGCGTTCACCAACGATATTAACTCCATTGTTCCAGACTTCTCCTTGATCGACTCCCTTGCGCACTTCGATAGAGAGCGCATCCCAGAGCGTGTTGTGA
GTCAAGTCTTTCCTGCGTCTACGCTCCCGTCCATAACCGTCCGCTCCTCTAGGTGCATGCTAAGGGTGCAGGATGCCACGGCTTCTTTGAGGTCACTCACGACATTACCGACTTGTCATG
CGCTGCCCTCTTCAGCGAGGTCGGCAAGAAGACCCCTGTGACCATGCGCTTCTCGACAGTCGGTGGAGAGCTTGGTTCTGCTGACTCTGCTCGTGACCCCCGAG
GTATGTCTTTCGCAAC
CTGGCAGTCGAGCCTGCCTGACCTCGACTGCAGGTTTCGCTATCAAGCTGAAGACGGAGCATGGAAACCTCGACTGGGTGTTCAACAACACTCCAATTTTCTTCATCCGCGACCCAGCGA
AGTTCCCACACTTCATCCACACTCAAAAGCGCGACCCGGAGACTCACCTCAAGGATGCCGATCCGTTCTGGGACTACTTCTCCCTGAACCCAGAGTCAATTCACCAGGTCATGATCTTGT
TCTCCGACCGCGGAACTCCTTACGGCTTCCATCATATGCACGGCTACTCGGGACACACCTATAAGTTCGTCAACGCTGAAGGCAAATTCGTTTATGTCCAAATTCACGTCCGTAAGGAGG
GCGGCTTCAAGACTATCGACAACGCTACTGCGGGTAAGCTCGCGGGTGAAAACCCCGACTACGGTATCGAGCTTCTCCACAACGACGTCGCCGCAGGCAAATTCCCTGAGTGGAAGTTGT
TCGTG
GTATGTATCTGCTGCTTGTCTCGCACCTCCCGTCATCTGATTCATGTCGCCGCAGCAAACCATGACCCCTGAGCAGGCTGAGAAGTTCCGTTACAACATTTGCGACCTGACCAAG
GTCTGGCCGCACGCAGAGTTCCCCCTCCGCCCCTTCGGCAAGATAGTGCTTAACAAGAACCCCGAGAACTACTTCGCCGAGGTGGAACAGGTGGCCTTCTCGCCCTCGCACACTGTCCCC
GGTTTCGAGCCGTCCAACGACCCGGTTCTGCAGTCCCGTCTGTTCTCGTACCCTGACACCCATCGTCACCGTCTCGGCACCAACTACCAGCAGCTGCCGGTCAACAGGCCTCTCGTCCCG
ATCGCGAACTTCCAGCGCGACGGCCCGATGGCGTTCGAGAACCAGGGCACGCGCCCGAACTACCAGAGCTCCCTTGTCCCGCTCACCTACAAGCCCAAGCCGTACGAACAGGTCAAGCAC
GAGACGTGGCTCGCCGCTGCGAAGACCGACCTCAGCTTCATCACCGAGC
GTATGTATCTCCTGCACTCTTTGATAGCGGGACGTGGGCTGACCGTCGCCGTGTGCAGTCGACTTCGAGCA
GCCCCGCGCGCTCTGGCAGAAGGTCTTCGACAACACCCAGAAGGAGCACTTCGTCTCCAACGTTGCTGGACACTTTGGCAACGTCAAGAGCCCGGAGGTCAAGGCTAGGCAGC
GTAAGTG
TCCCTTAACACTCGTCTCGTTGGATAATGTCTCATATGGTGGTCCGCAGTCTCTGTCTTCGCTGCCGTCGACCAGGACCTCTCCGACCGCATCGCCAAGGCCATCGGTCACCCATCGGTC
AAGCCCTTGTCGGTCGCCCCCGCCGCGCAGGCCATCCGCTTCCAGTACAACCAGAGTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCGACCAAGCGCGCTCTGGAAGCTCAAGACAAAGCGGTCTACACGACCTCCAGCGGTGCCCCCGTTGCCGAACCCTACGCCGCTCAGCGCGTTGGCAACAACGGACCCCTCCTCCTT
CAAG
ACTTCTCCTTGATCGACTCCCTTGCGCACTTCGATAGAGAGCGCATCCCAGAGCGTGTTGTGCATGCTAAGGGTGCAGGATGCCACGGCTTCTTTGAGGTCACTCACGACATTACC
GACTTGTCATGCGCTGCCCTCTTCAGCGAGGTCGGCAAGAAGACCCCTGTGACCATGCGCTTCTCGACAGTCGGTGGAGAGCTTGGTTCTGCTGACTCTGCTCGTGACCCCCGAG
GTTTC
GCTATCAAGCTGAAGACGGAGCATGGAAACCTCGACTGGGTGTTCAACAACACTCCAATTTTCTTCATCCGCGACCCAGCGAAGTTCCCACACTTCATCCACACTCAAAAGCGCGACCCG
GAGACTCACCTCAAGGATGCCGATCCGTTCTGGGACTACTTCTCCCTGAACCCAGAGTCAATTCACCAGGTCATGATCTTGTTCTCCGACCGCGGAACTCCTTACGGCTTCCATCATATG
CACGGCTACTCGGGACACACCTATAAGTTCGTCAACGCTGAAGGCAAATTCGTTTATGTCCAAATTCACGTCCGTAAGGAGGGCGGCTTCAAGACTATCGACAACGCTACTGCGGGTAAG
CTCGCGGGTGAAAACCCCGACTACGGTATCGAGCTTCTCCACAACGACGTCGCCGCAGGCAAATTCCCTGAGTGGAAGTTGTTCGTG
CAAACCATGACCCCTGAGCAGGCTGAGAAGTTC
CGTTACAACATTTGCGACCTGACCAAGGTCTGGCCGCACGCAGAGTTCCCCCTCCGCCCCTTCGGCAAGATAGTGCTTAACAAGAACCCCGAGAACTACTTCGCCGAGGTGGAACAGGTG
GCCTTCTCGCCCTCGCACACTGTCCCCGGTTTCGAGCCGTCCAACGACCCGGTTCTGCAGTCCCGTCTGTTCTCGTACCCTGACACCCATCGTCACCGTCTCGGCACCAACTACCAGCAG
CTGCCGGTCAACAGGCCTCTCGTCCCGATCGCGAACTTCCAGCGCGACGGCCCGATGGCGTTCGAGAACCAGGGCACGCGCCCGAACTACCAGAGCTCCCTTGTCCCGCTCACCTACAAG
CCCAAGCCGTACGAACAGGTCAAGCACGAGACGTGGCTCGCCGCTGCGAAGACCGACCTCAGCTTCATCACCGAGC
TCGACTTCGAGCAGCCCCGCGCGCTCTGGCAGAAGGTCTTCGAC
AACACCCAGAAGGAGCACTTCGTCTCCAACGTTGCTGGACACTTTGGCAACGTCAAGAGCCCGGAGGTCAAGGCTAGGCAGC
TCTCTGTCTTCGCTGCCGTCGACCAGGACCTCTCCGAC
CGCATCGCCAAGGCCATCGGTCACCCATCGGTCAAGCCCTTGTCGGTCGCCCCCGCCGCGCAGGCCATCCGCTTCCAGTACAACCAGAGTGCTTAA

Retrieve as FASTA