Entry information : PcarLiPC
Entry ID 9961
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-29 (Christophe Dunand)
Peroxidase information: PcarLiPC
Name PcarLiPC
Class Lignin peroxidase    [Orthogroup: LiP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete carnosa    [TaxId: 231932 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcarLiPC
start..stop
S start..stop
PcLiP03_BKMF1767 622 0 1..371 1..371
PcarLiP04 621 0 1..371 1..372
PsoLiP03 618 0 1..371 1..372
PcarLiP01 616 0 1..371 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 405247..405307 61 N° 2 405362..405512 151 N° 3 405566..405622 57 N° 4 405678..405892 215
N° 5 405945..405986 42 N° 6 406040..406118 79 N° 7 406171..406296 126 N° 8 406356..406471 116
N° 9 406533..406714 182 N° 10 406775..406839 65 N° 11 406895..406916 22  
join(405247..405307,405362..405512,405566..405622,405678..405892,405945..405986, 406040..406118,406171..406296,406356..406471,406533..406714,406775..406839,40689 5..406916)


exon

Literature and cross-references PcarLiPC
DNA ref. JGI genome:   scaffold_9 (405247..406837)
Protein sequence: PcarLiPC
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (350)
PWM (Da):   %s   39353.3 (37063.0)  
PI (pH):   %s   4.13 (4.01) Peptide Signal:   %s   cut: 22 range:22-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKKLLCVLFTALSLRAVQGAVVEKRATCSNGVAVSNESCCAWFTVLEDIQENLFNGGQCGAEAHESIRLVFHDAIAISPALEAEGQFGGGGADGSIMIFDEIETNFEANVGLDEIVKLQKPFVQRHGVTPGDFIAFAGAVAMSNCPGAPQMNFFTGRAATQAAPDGLVPEPFDSVDKIIARVDDAGQFDELELVWMLSAHSVAASNDIDPTIEGLPFDSTPGIFDSQFFVETQLVGTGFPGSSGNQGEVESPLRGEMRLQSDFSIARDSRTACEWQSFNNQSKLTSDFQFIFLALTQLGQNPDVMTDCSAVIPLSRAIPGNRPFSFFPAGKTVADVQQCASTPFPTLTTLPGPETSVARIPPPPGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGAAACTGCTCTGCGTCCTTTTCACCGCTCTCTCTCTTCGCGCCGTTCAAGGTACGTGGCTGCCTGCTCAGGAGCCGCTGCAAGGCGCTGACGACGATGTCTCAGGTGCT
GTCGTCGAGAAGCGTGCCACTTGCTCTAACGGCGTCGCCGTTAGCAACGAATCGTGCTGCGCCTGGTTCACCGTCCTCGAAGACATCCAGGAGAACCTCTTCAACGGCGGCCAGTGTGGT
GCTGAGGCCCATGAGTCTATCCGTCT
GTAAGGATGGCAAATGCCCATTACTCAATGACTGTGCGCTGACACAGTCGTAGCGTCTTTCACGACGCCATCGCTATCTCTCCCGCGCTGGAGG
CCGAGGGCCAGTTCGG
GTATGTATTCGCTGCCCTCGGCGTCGTCTTAGTATCTCACAATACTGCGTGCCAGTGGTGGAGGTGCCGATGGCTCTATCATGATCTTCGACGAGATAGAGACC
AACTTCGAGGCAAATGTCGGCCTTGACGAAATTGTTAAGCTGCAGAAGCCCTTTGTGCAGAGGCACGGCGTCACACCCGGAGACTTCATTGCCTTCGCTGGTGCGGTCGCGATGAGCAAC
TGCCCCGGTGCTCCGCAGATGAATTTCTTCACCGGACGCGCTCCCG
GTACGCTCAACAAGTTTCTCCAGCAAACAGAGCTCTGACTCGTGCTTTACAGCCACCCAAGCTGCTCCCGATGG
CCTTGTCCCCGAGCCTTTTG
GTATGGTCTCAGGACGGCACGGACACCCATCCCCCAACTTATCACCTTCACAGATTCCGTTGACAAGATCATCGCTCGCGTTGACGATGCTGGCCAGTTC
GATGAGCTCGAACTTGTCTGGATGCTTTCTGC
GTGAGTAGCCCGTGCGTTTGCTACCGCATATACACTGACCATCCAACCCCAGTCATTCCGTTGCCGCCTCCAACGACATTGACCCGAC
CATCGAGGGTTTGCCGTTTGACTCCACTCCTGGCATCTTCGATTCCCAGTTCTTTGTCGAGACCCAGCTCGTTGGCACTGGCTTCCCGGG
GTATGTTATCTTTGACTGAGTGCCTGTGTG
CGCGGAGCGCTCACCGCTTGTTTGTTCAGCTCCTCCGGCAATCAGGGAGAGGTGGAGTCGCCGCTCCGGGGCGAGATGCGTCTTCAGTCCGACTTTTCTATCGCGCGCGACTCGCGCACA
GCCTGCGAGTGGCAGTCCTTTGTCA
GTGCGTACCGCTCTGTGCATTCCTCGTCGTAGCAGAAACACGCTCACCATGCCCCCCGCAGACAACCAATCGAAGCTGACGAGTGACTTCCAGTT
CATCTTCCTCGCGCTCACCCAGCTTGGCCAGAACCCGGACGTGATGACCGACTGCTCGGCCGTCATTCCGCTCTCAAGGGCGATCCCCGGAAACCGCCCGTTCTCGTTCTTCCCCGCCGG
CAAGACCGTCGCCGATGTCCAGCAGGCC
GTGCGTACCCCCGCGACGCTGTGCATCAGGCGTGCAAGCCGCTGACCGCTCTCCTTGTAGTGTGCGTCCACGCCTTTTCCGACCCTCACGAC
TCTCCCTGGCCCCGAGACCTCGGTTGCGCGCAT
GTACGTGCCCGCCAACAGCCACAAAGCTACCTTCGCTGACAATTTGCTCCCATAGCCCCCCGCCGCCTGGTGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGAAACTGCTCTGCGTCCTTTTCACCGCTCTCTCTCTTCGCGCCGTTCAAGGTGCTGTCGTCGAGAAGCGTGCCACTTGCTCTAACGGCGTCGCCGTTAGCAACGAATCG
TGCTGCGCCTGGTTCACCGTCCTCGAAGACATCCAGGAGAACCTCTTCAACGGCGGCCAGTGTGGTGCTGAGGCCCATGAGTCTATCCGTCT
CGTCTTTCACGACGCCATCGCTATCTCT
CCCGCGCTGGAGGCCGAGGGCCAGTTCGG
TGGTGGAGGTGCCGATGGCTCTATCATGATCTTCGACGAGATAGAGACCAACTTCGAGGCAAATGTCGGCCTTGACGAAATTGTTAAGCTG
CAGAAGCCCTTTGTGCAGAGGCACGGCGTCACACCCGGAGACTTCATTGCCTTCGCTGGTGCGGTCGCGATGAGCAACTGCCCCGGTGCTCCGCAGATGAATTTCTTCACCGGACGCGCT
CCCG
CCACCCAAGCTGCTCCCGATGGCCTTGTCCCCGAGCCTTTTGATTCCGTTGACAAGATCATCGCTCGCGTTGACGATGCTGGCCAGTTCGATGAGCTCGAACTTGTCTGGATGCTT
TCTGC
TCATTCCGTTGCCGCCTCCAACGACATTGACCCGACCATCGAGGGTTTGCCGTTTGACTCCACTCCTGGCATCTTCGATTCCCAGTTCTTTGTCGAGACCCAGCTCGTTGGCACT
GGCTTCCCGGG
CTCCTCCGGCAATCAGGGAGAGGTGGAGTCGCCGCTCCGGGGCGAGATGCGTCTTCAGTCCGACTTTTCTATCGCGCGCGACTCGCGCACAGCCTGCGAGTGGCAGTCC
TTTGTCA
ACAACCAATCGAAGCTGACGAGTGACTTCCAGTTCATCTTCCTCGCGCTCACCCAGCTTGGCCAGAACCCGGACGTGATGACCGACTGCTCGGCCGTCATTCCGCTCTCAAGG
GCGATCCCCGGAAACCGCCCGTTCTCGTTCTTCCCCGCCGGCAAGACCGTCGCCGATGTCCAGCAGGCC
TGTGCGTCCACGCCTTTTCCGACCCTCACGACTCTCCCTGGCCCCGAGACC
TCGGTTGCGCGCAT
CCCCCCGCCGCCTGGTGCGTAG

Retrieve as FASTA