Entry information : AcoPrx102
Entry ID 9969
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx102
Name AcoPrx102
Class Class III peroxidase     [Orthogroup: Prx167]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx102
start..stop
S start..stop
AcoPrx54 321 3e-110 1..195 224..414
AcoPrx103 313 2e-107 1..195 224..415
AcoPrx[P]111 145 1e-45 1..100 1..104
AcoPrx[P]113 100 3e-28 1..86 1..79
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2838336..2838618 283 N° 2 2838685..2838986 302  
join(2838336..2838618,2838685..2838986)


exon

Literature and cross-references AcoPrx102
DNA ref. Phytozome 12:   scaffold_10 (2838336..2838986)
Protein sequence: AcoPrx102
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195
PWM (Da):   %s   21405.84  
PI (pH):   %s   7.29
Sequence 236
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DGNDTIVYIGGVEITQPDFFYNGLVVVHRLEGFISPLSPFSCNIERMTPLSFPSPQSENRTNAQSIITPPSPAIMRLMLKDAMLRLHNNGFSVLYDPAIFSGGHAYLNNFRFHIVPNRLLMSADLMRLPTGTTLPTMDHSGDSLMITTGGSGGGQMRINYVRIKTPDVVYNLKIAVHSVFLSFPHLHPATVEFGG

Retrieve as FASTA  
Remarks Partial sequence from genomic (Both 5' end and 3' end are missing which can not be found in genomic). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGATACGATCGTGTACATTGGTGGAGTAGAGATTACTCAACCTGATTTCTTCTACAATGGCCTCGTAGTTGTTCATCGTCTTGAAGGTTTTATCTCTCCTTTATCTCCATTCT
CGTGTAACATAGAAAGGATGACTCCTCTATCTTTTCCTTCACCACAATCTGAGAATCGAACCAATGCACAATCAATCATTACTCCTCCTTCCCCTGCTATTATGCGCTTAATGCTTAAAG
ATGCTATGCTTCGCCTTCATAATAATGGTTTCAGTGTTCTTT
CTCTCGCTCTAAGAGTAAAATATCCAGAACTTGTAAATCTTCAGAATTTCACTGTGTTTGCTCTAGATGATCCTGCAA
TCTTTTCTGGCGGCCATGCCTATCTTAACAATTTCAGATTTCATATCGTACCTAATCGCTTGTTAATGAGTGCTGATCTAATGAGGCTGCCAACAGGCACTACTTTGCCTACAATGGATC
ACAGTGGTGACTCATTGATGATTACTACTGGAGGAAGTGGAGGTGGTCAGATGAGGATCAATTACGTAAGAATCAAGACTCCTGATGTGGTTTACAATCTCAAGATTGCTGTTCACAGTG
TATTCTTGTCATTTCCTCATCTTCATCCAGCTACTGTGGAGTTTGGAGGT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAATGATACGATCGTGTACATTGGTGGAGTAGAGATTACTCAACCTGATTTCTTCTACAATGGCCTCGTAGTTGTTCATCGTCTTGAAGGTTTTATCTCTCCTTTATCTCCATTCT
CGTGTAACATAGAAAGGATGACTCCTCTATCTTTTCCTTCACCACAATCTGAGAATCGAACCAATGCACAATCAATCATTACTCCTCCTTCCCCTGCTATTATGCGCTTAATGCTTAAAG
ATGCTATGCTTCGCCTTCATAATAATGGTTTCAGTGTTCTTT
ATGATCCTGCAATCTTTTCTGGCGGCCATGCCTATCTTAACAATTTCAGATTTCATATCGTACCTAATCGCTTGTTAA
TGAGTGCTGATCTAATGAGGCTGCCAACAGGCACTACTTTGCCTACAATGGATCACAGTGGTGACTCATTGATGATTACTACTGGAGGAAGTGGAGGTGGTCAGATGAGGATCAATTACG
TAAGAATCAAGACTCCTGATGTGGTTTACAATCTCAAGATTGCTGTTCACAGTGTATTCTTGTCATTTCCTCATCTTCATCCAGCTACTGTGGAGTTTGGAGGT

Retrieve as FASTA