Entry information : ZmPrx101 (GRMZM2G107228)
Entry ID 997
Creation 2007-11-13 (Christophe Dunand)
Last sequence changes 2007-11-13 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-29 (Qiang Li)
Peroxidase information: ZmPrx101 (GRMZM2G107228)
Name (synonym) ZmPrx101 (GRMZM2G107228)
Class Class III peroxidase    [Orthogroup: Prx116]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Ovaries
Silks
Inducer Fusarium infection
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx101
start..stop
S start..stop
SofPrx06 625 0 1..368 1..372
SbPrx61 599 0 1..368 1..364
SiPrx01 582 0 1..337 1..339
BdiPrx63 541 0 11..367 1..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 59325442..59325690 249 N° 2 59326321..59326746 426 N° 3 59326855..59327286 432  
join(59325442..59325690,59326321..59326746,59326855..59327286)


exon

Literature and cross-references ZmPrx101 (GRMZM2G107228)
Literature Harris,L.J. et al., unpublished
Protein ref. UniProtKB:   B4FU88
DNA ref. GenBank:   AC209994 (61772..63613)
mRNA ref. GenBank:   BT040676
EST ref. GenBank:   EE169593 [5' end]   DT937846 [3' end]
Cluster/Prediction ref. UniGene:   Zm.10377
Protein sequence: ZmPrx101 (GRMZM2G107228)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368
PWM (Da):   %s   38189.11 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.03
Sequence 409
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPVASKGVVMDGAVAVAAVAAAVLLCLHLPAVARGQLQVGFYNTSCPNAESLVRQAVASAFANDSGIAAGLIRLLFHDCFVRGCDASVLLTSANNTAERDAPPNNPSLHGFQVIDAAKAAVEQSCPQTVSCADIVAFAARDSINLTGNLPYQVPSGRRDGNVSLDTEANSNLPAPTFNASQLVASFAAKNLTDEEMVILSGAHTVGRSFCTSFLARIYNGSTPIVDSGLSAGYATLLRALCPSNANSSTPTTTVIDPSTPAVLDNNYYKLLPLNLGLFFSDNQLRVNSTLNASVNSFAANETLWKEKFVAAMVKMGNIQVLTGTQGQIRLNCSIVNNGSSSVGIQQMTVPNSYSGATASLDDEIATS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, intron 1 and 3') and 22 ESTs. Also found in AC217114.5. Containing IntR (3').
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTCCGGTTGCAAGCAAGGGAGTAGTGATGGACGGTGCGGTGGCGGTGGCGGCAGTGGCCGCCGCCGTGCTGCTGTGCCTCCATCTGCCGGCGGTGGCGCGAGGCCAGCTGCAGGTGG
GGTTCTACAACACGAGCTGCCCCAACGCCGAGTCCCTGGTCCGCCAGGCGGTGGCCAGCGCGTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCTTTTCCACGACTGCT
TCGTCAGG
GTACGTATACATGGATCTGTTTGGGTTCCTTCTCTGCTACTTATACTAAGAGCATCTCCAACAACGTGACCTATAAATGCTTTATAATTTTAAAATAAGTAAATTTTATAGA
ATTTAGGGCACCAACAAAACACTCCGCTCCAACAATAAAGCCCCAAATTTAGATTATATGGCAGCCCACTACGGTGTAGTATATTTGAGCCACTTAAGAGAGTGCCCTATAGTTTTTTGA
CAAAATTTGTTGAATTGACGCACTGTTGGAGTGGTTTTTCCTGTGTAGAGCCCTATATTTCGATTTGAGGCATTAATTTGAGTCATTGTTGGAGATGATCTAAGGGAAATTCCCATCGTA
TCGAATAAAGGGTTCACAGTAATCGACATACATATGCCTTGTTTTGGTTTCTTTGGTCGGTTTCCCTTCTTTTTGGGCTTGTGCTTTTGCATGTAAAAAAGAACATTCAACTCTCGTTGT
TCTCTTTACATGCATGGCTAGTTTGTGGTTGTCGTGGTCTTGTTTGTGGTCATCCCTGCCCACTGTACATAGTCACACAGTAGTATCTTCATCTGTCTACTCGATCTCTACTTGTGATTT
TGCAAACGGGATGATGCTCTCATGGTGGTGGTGAACAGGGCTGCGATGCGTCGGTGCTGCTGACCTCCGCCAACAACACGGCGGAGCGTGACGCGCCGCCCAACAACCCGAGCCTCCACG
GGTTCCAGGTGATCGACGCGGCGAAGGCGGCGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACATCGTGGCCTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTGC
CGTACCAGGTGCCCTCGGGCCGCCGGGACGGCAACGTCTCCCTCGACACGGAGGCCAACAGCAACCTGCCGGCGCCAACGTTCAACGCGTCCCAGCTGGTGGCCAGCTTCGCGGCCAAGA
ACCTCACCGACGAGGAGATGGTCATCCTCTCCGGCGCCCACACCGTCGGCCGCTCCTTCTGCACATCGTTTCTCGCGCGCATCTACAACGGATCCACCCCGATC
GTACGTACAGTACAGA
TACTGTAAATAGATACTATGATACATCTTCCATTCGTTGTCTTATATACGTATCAGCTAACAACGATTGACGTCCAATGCAATGCTATGCAGGTTGACTCTGGCCTGAGCGCCGGGTACG
CCACACTGCTGCGCGCGCTGTGCCCGTCCAACGCCAACTCGTCCACGCCCACGACCACGGTGATCGACCCCAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCA
ACCTGGGCCTCTTCTTCTCCGACAACCAGCTGCGCGTCAACTCCACGCTCAACGCCTCCGTCAACAGCTTCGCCGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGGTCA
AGATGGGAAACATCCAGGTGCTCACGGGGACCCAGGGCCAGATCAGGCTCAACTGCAGCATCGTCAACAACGGCTCGTCGTCGGTGGGGATCCAGCAGATGACAGTGCCCAACTCCTACT
CTGGCGCCACCGCGTCCCTTGATGATGAGATCGCCACGAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTCCGGTTGCAAGCAAGGGAGTAGTGATGGACGGTGCGGTGGCGGTGGCGGCAGTGGCCGCCGCCGTGCTGCTGTGCCTCCATCTGCCGGCGGTGGCGCGAGGCCAGCTGCAGGTGG
GGTTCTACAACACGAGCTGCCCCAACGCCGAGTCCCTGGTCCGCCAGGCGGTGGCCAGCGCGTTCGCCAACGACTCCGGCATCGCCGCCGGCCTCATCCGCCTCCTTTTCCACGACTGCT
TCGTCAGG
GGCTGCGATGCGTCGGTGCTGCTGACCTCCGCCAACAACACGGCGGAGCGTGACGCGCCGCCCAACAACCCGAGCCTCCACGGGTTCCAGGTGATCGACGCGGCGAAGGCGG
CGGTGGAGCAGAGCTGCCCGCAGACGGTGTCGTGCGCGGACATCGTGGCCTTCGCGGCGCGCGACAGCATCAACCTCACGGGCAACCTGCCGTACCAGGTGCCCTCGGGCCGCCGGGACG
GCAACGTCTCCCTCGACACGGAGGCCAACAGCAACCTGCCGGCGCCAACGTTCAACGCGTCCCAGCTGGTGGCCAGCTTCGCGGCCAAGAACCTCACCGACGAGGAGATGGTCATCCTCT
CCGGCGCCCACACCGTCGGCCGCTCCTTCTGCACATCGTTTCTCGCGCGCATCTACAACGGATCCACCCCGATC
GTTGACTCTGGCCTGAGCGCCGGGTACGCCACACTGCTGCGCGCGC
TGTGCCCGTCCAACGCCAACTCGTCCACGCCCACGACCACGGTGATCGACCCCAGCACGCCGGCGGTGCTGGACAACAACTACTACAAGCTGCTGCCGCTCAACCTGGGCCTCTTCTTCT
CCGACAACCAGCTGCGCGTCAACTCCACGCTCAACGCCTCCGTCAACAGCTTCGCCGCCAACGAGACGCTCTGGAAGGAGAAGTTCGTCGCCGCCATGGTCAAGATGGGAAACATCCAGG
TGCTCACGGGGACCCAGGGCCAGATCAGGCTCAACTGCAGCATCGTCAACAACGGCTCGTCGTCGGTGGGGATCCAGCAGATGACAGTGCCCAACTCCTACTCTGGCGCCACCGCGTCCC
TTGATGATGAGATCGCCACGAGCTGA

Retrieve as FASTA