Entry information : AcoPrx103
Entry ID 9970
Creation 2011-11-25 (Qiang LI)
Last sequence changes 2016-02-04 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-04 (Achraf Jemmat)
Peroxidase information: AcoPrx103
Name AcoPrx103
Class Class III peroxidase    [Orthogroup: Prx258]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx103
start..stop
S start..stop
AcoPrx54 872 0 1..442 1..441
AcoPrx102 313 5e-107 224..415 1..195
AcoPrx06 264 3e-85 32..218 22..219
AfpPrx11 264 3e-85 32..218 22..219
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3603272..3603592 321 N° 2 3603721..3603912 192 N° 3 3604014..3604829 816  
join(3603272..3603592,3603721..3603912,3604014..3604829)


exon

Literature and cross-references AcoPrx103
DNA ref. Phytozome 12:   scaffold_24 (3603272..3604826)
Protein sequence: AcoPrx103
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   442
PWM (Da):   %s   48890.73  
PI (pH):   %s   6.31
Sequence 484
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWVILPSKILSCGASSSVPGKKQSVSLLLFLGKQSGEQINKGSSSFSWIPSLLYFNNEIKIGDSIDFEYDYYNDEELVESMMRYLYKTQTDVTPALLCLVFHDFLIQKRDGSVLMDSLNAGNQSEKDTVPNWSMKGFNIIEKSKSKVEEECPATVSYVDILILAAREGIILAGCPYYPVTTGRSNSLVSFPEIAAFDIPSPNDDLSKTITLFASRGFTSASSRDGxNDNIMYIGGAEITQPNFFYNGTVVGHCLEGFISPFCDIERMTPLSFPSPQSDNRTNPRLINTLPSPAIMRLMIKDGMFQLHTTGFSVLNDPAIFSDGHAYCNNFRFHIVPNRLLTSADLMRLPTGTTLPTMDHSGDSLIITNGGSRGGQMRINYIRIKTPDVVYNLKIAVQSVLLPFPHLHSATVEFRGMEALALCMILPLRLVILLCLRQKGLCR*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGGTTATTCTTCCATCGAAAATTCTAAGTTGTGGTGCGTCTTCCTCTGTTCCTGGAAAGAAACAGAGTGTCTCTTTACTTCTCTTTCTTGGTAAACAAAGTGGTGAACAGATAAATA
AGGGTAGTTCATCTTTTTCATGGATTCCTTCTCTTCTTTACTTCAATAACGAAATAAAGATCGGTGATTCTATTGATTTTGAATACGATTACTATAATGATGAAGAACTTGTTGAATCGA
TGATGCGATATCTTTACAAAACTCAAACTGATGTTACTCCAGCTTTATTGTGTTTGGTGTTTCATGATTTCTTGATTCAG
GTTTGTTTTTTAGCTAATTTACTGAATTTTTGTCTTACAA
TGGGATTTTGATTTCATTAGGGTTTTAGTGGGTTTTGTGTTAATTTAATTTGATTTGATTGTTTTGAATGAAATGGGGATTCTTGTAGAAACGTGATGGATCTGTTCTAATGGATTCTCT
CAATGCTGGAAATCAATCTGAGAAAGATACTGTACCTAATTGGTCAATGAAAGGTTTCAATATAATCGAAAAAAGCAAATCCAAAGTCGAAGAAGAGTGTCCTGCAACAGTTTCTTACGT
TGATATTCTTATTCTTGCAGCTAGAGAAGGAATTATTTTG
GTAATGCATTGATTATGTTGGTGTTTTGGTAATGTATTCATTATTTTGGTGTTTTGGTGTTTTCGTCGATTTGCTCTTCT
GATTGTTTGTTGTTATTGCAGGCTGGTTGTCCTTACTATCCTGTGACTACCGGAAGGAGTAATAGCCTTGTATCGTTTCCTGAAATTGCCGCTTTTGACATTCCATCTCCTAATGATGAT
CTTTCCAAGACCATTACATTATTTGCTAGTAGAGGATTTACTTCTGCAAGTAGCAGAGATGGANNNAATGATAATATCATGTACATTGGTGGAGCAGAGATCACTCAACCTAATTTCTTC
TACAACGGTACCGTAGTTGGTCATTGTCTTGAAGGTTTTATCTCTCCTTTTTGTGACATAGAAAGGATGACTCCTCTATCTTTTCCTTCTCCACAATCTGATAATCGCACAAATCCACGA
TTAATTAATACTCTGCCTTCCCCTGCTATTATGCGTCTGATGATTAAAGATGGTATGTTTCAACTTCATACTACTGGTTTCAGTGTTCTTAATGATCCTGCAATCTTTTCTGATGGCCAT
GCCTATTGTAACAATTTCAGATTCCATATCGTACCTAATCGCTTGTTAACGAGTGCTGATCTAATGAGGCTGCCAACAGGCACTACTTTGCCTACAATGGATCACAGTGGTGACTCCTTG
ATAATTACTAATGGAGGAAGTAGAGGTGGTCAGATGAGGATCAATTACATAAGAATCAAGACTCCTGATGTGGTTTACAATCTCAAGATTGCGGTTCAGAGTGTACTCTTGCCATTTCCT
CATCTTCATTCAGCTACTGTGGAGTTTCGAGGTATGGAGGCACTGGCACTTTGTATGATTCTGCCGCTGCGGTTGGTGATCCTGCTATGTTTAAGACAAAAAGGGCTCTGCAGATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGGTTATTCTTCCATCGAAAATTCTAAGTTGTGGTGCGTCTTCCTCTGTTCCTGGAAAGAAACAGAGTGTCTCTTTACTTCTCTTTCTTGGTAAACAAAGTGGTGAACAGATAAATA
AGGGTAGTTCATCTTTTTCATGGATTCCTTCTCTTCTTTACTTCAATAACGAAATAAAGATCGGTGATTCTATTGATTTTGAATACGATTACTATAATGATGAAGAACTTGTTGAATCGA
TGATGCGATATCTTTACAAAACTCAAACTGATGTTACTCCAGCTTTATTGTGTTTGGTGTTTCATGATTTCTTGATTCAG
AAACGTGATGGATCTGTTCTAATGGATTCTCTCAATGCTG
GAAATCAATCTGAGAAAGATACTGTACCTAATTGGTCAATGAAAGGTTTCAATATAATCGAAAAAAGCAAATCCAAAGTCGAAGAAGAGTGTCCTGCAACAGTTTCTTACGTTGATATTC
TTATTCTTGCAGCTAGAGAAGGAATTATTTTG
GCTGGTTGTCCTTACTATCCTGTGACTACCGGAAGGAGTAATAGCCTTGTATCGTTTCCTGAAATTGCCGCTTTTGACATTCCATCTC
CTAATGATGATCTTTCCAAGACCATTACATTATTTGCTAGTAGAGGATTTACTTCTGCAAGTAGCAGAGATGGANNNAATGATAATATCATGTACATTGGTGGAGCAGAGATCACTCAAC
CTAATTTCTTCTACAACGGTACCGTAGTTGGTCATTGTCTTGAAGGTTTTATCTCTCCTTTTTGTGACATAGAAAGGATGACTCCTCTATCTTTTCCTTCTCCACAATCTGATAATCGCA
CAAATCCACGATTAATTAATACTCTGCCTTCCCCTGCTATTATGCGTCTGATGATTAAAGATGGTATGTTTCAACTTCATACTACTGGTTTCAGTGTTCTTAATGATCCTGCAATCTTTT
CTGATGGCCATGCCTATTGTAACAATTTCAGATTCCATATCGTACCTAATCGCTTGTTAACGAGTGCTGATCTAATGAGGCTGCCAACAGGCACTACTTTGCCTACAATGGATCACAGTG
GTGACTCCTTGATAATTACTAATGGAGGAAGTAGAGGTGGTCAGATGAGGATCAATTACATAAGAATCAAGACTCCTGATGTGGTTTACAATCTCAAGATTGCGGTTCAGAGTGTACTCT
TGCCATTTCCTCATCTTCATTCAGCTACTGTGGAGTTTCGAGGTATGGAGGCACTGGCACTTTGTATGATTCTGCCGCTGCGGTTGGTGATCCTGCTATGTTTAAGACAAAAAGGGCTCT
GCAGATAA

Retrieve as FASTA