Entry information : AcoPrx[P]112
Entry ID 9983
Creation 2011-12-14 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx[P]112
Name AcoPrx[P]112
Class Class III peroxidase     [Orthogroup: Prx090]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]112
start..stop
S start..stop
AcoPrx46 319 1e-110 1..202 2..200
AcoPrx10 318 4e-110 1..202 2..200
AfpPrx15 316 1e-109 1..202 2..200
AcoPrx07 268 2e-90 25..202 25..201
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10526127..10526372 246 N° 2 10526668..10526867 200 N° 3 10526988..10527145 158  
join(10526127..10526372,10526668..10526867,10526988..10527145)


exon

Literature and cross-references AcoPrx[P]112
DNA ref. Phytozome 12:   scaffold_1 (10526127..10527145)
Protein sequence: AcoPrx[P]112
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   200 (305)
PWM (Da):   %s   20891.73 (32229.2)  
PI (pH):   %s   6.22 (8.41) Peptide Signal:   %s   cut: 24 range:24-328
Sequence 243
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TSSSASFISLLLVSSLLLGSQLSETTAQATPPLVAGLSYDFCSTNCPSLETTIREYLREIFSSDFGVAAGLLRVHFHDCFVQQGCDGLVLLAGSASGPGEQAAPPNLTLRPRAFVIINELLNRIHRACGAIVSCAxFFTALCARDAVFLTGGPDY*VPLGA*WDGVTFATRIATLANLPFFGSRVPTLIAxFCRKNLDVTIL

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame; Both 5' and 3' ends are missing). No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCTTCTTCTGCTTCATTCATATCCCTTCTCTTAGTTTCTTCTCTTCTTCTTGGTTCTCAGTTGTCTGAAACAACTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATATGATT
TCTGTAGCACTAATTGTCCTTCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTTAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGCTTTG
TTCAG
GTACTCAGTTATTTTTTATTCATCATCTGTTTTCATATAATTATATGTTGTTTAGGTAAAATACTTATTATGGTAAATGTTGTTGAATCTAATATTTTTTAGTCAACATCAATGA
TCCATAAAGGCGTTATTATTATGAGTTTGGCAAGCTGACTTCAAATTTCACTAGTTGACTTATTTGAACCTGATTCAGTGAAAATATTTTCCTGTCGAGATCTTACTGTTCATAACATGT
ATATAGTAACAAGACTTGCATGATTATTATTTGTGATTGATATACGTAGATGTCTATGTGCAGGGATGTGATGGTTTAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTGGTGAACAAGCC
GCACCACCGAACTTGACATTGAGACCAAGAGCATTTGTTATCATCAATGAACTTCTTAACCGCATCCATAGGGCTTGTGGTGCAATCGTTTCTTGCGCTGANTTTTTTACTGCCCTGTGT
GCTCGCGACGCCGTTTTCCT
GGTAACCCGGCCTCACAACTTATATCTTCTATTTAATTTCGGCAGAGCTAACTGACGAGAAGAAAAAGATTCGTAAACCAATTGAAGAAATAACAAACTA
ATTCGTGTTCATGGTGTGCTGACTGGTGGTCCAGATTACTGAGTTCCTCTAGGGGCGTGATGGGATGGGGTCACTTTTGCAACAAGAATAGCAACACTAGCCAACCTACCATTTTTCGGT
TCAAGGGTACCAACGCTTATTGCTGANTTTTGCCGTAAGAACTTGGATGTAACTATTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTCTTCTTCTGCTTCATTCATATCCCTTCTCTTAGTTTCTTCTCTTCTTCTTGGTTCTCAGTTGTCTGAAACAACTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATATGATT
TCTGTAGCACTAATTGTCCTTCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTTAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGCTTTG
TTCAG
CAGGGATGTGATGGTTTAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTGGTGAACAAGCCGCACCACCGAACTTGACATTGAGACCAAGAGCATTTGTTATCATCAATGAACTTC
TTAACCGCATCCATAGGGCTTGTGGTGCAATCGTTTCTTGCGCTGANTTTTTTACTGCCCTGTGTGCTCGCGACGCCGTTTTCCT
GACTGGTGGTCCAGATTACTGAGTTCCTCTAGGGG
CGTGATGGGATGGGGTCACTTTTGCAACAAGAATAGCAACACTAGCCAACCTACCATTTTTCGGTTCAAGGGTACCAACGCTTATTGCTGANTTTTGCCGTAAGAACTTGGATGTAACTA
TTT

Retrieve as FASTA