A. Input format

The data submitted by the user should be in FASTA format. The FASTA header is as follows : ">Accession_id|sequence name" for exemple : >5546|Sb1CysPrx01

An example of the protein sequences format:
>1064|OsPrx54
MALLLLRRGGGFAAATVLAVVVVALVLSCGGGAEAAVRDLRVGYYAETCPDAEAVVRDTMARARAHEARSVASVMRLQFH
>1049|OsPrx39
MAATLRWGGGGLAVAAFAAVVALSGLLGVAANYGGGGGFLFPQFYQHTCPQMEAVVGGIVARAHAEDPRMAASLLRMHFH

An example of the genomic sequences format:
>1064|OsPrx54
ATGGCGGCGACATTGCGTTGGGGCGGCGGCGGGCTCGCGGTGGCGGCGTTTGCGGCGGTGGTCGCGTTGTCCGGCCT
CCT
>1049|OsPrx39
ATGGGCGCTGTGGCTGCGGTTCGTGCCGCGGTCCTGGTCGTGGCCGTGGCCCTCGCCGCGGCGGCGGCCGGCGCGTC
GGC

The gene structure information given in Genbank format. For exemple :
join(203122798..203122892,203126718..203126874,203130660..203130806,203131568..203131714,
203133072..203133200)
OR:
complement(join(1..672))

B. CIWOG Results:

Once the data is submitted, you will be directed to the CIWOG Results page. This page gives access to the different results generated by CIWOG, which are: *the multiple alignment file and the *CIWOG Results.



C. CIWOG homepage:

http://ciwog.gdcb.iastate.edu/